The mechanical and thermal stability of biomaterials is crucial for their performance in physiological environments, especially in load-bearing or long-term implant applications. This study evaluates how the incorporation of sulfur-doped…
This study addresses the critical gap between laboratory-scale battery innovation and industrial-scale sustainability by providing a transparent, data-driven analysis of energy flows in lithium-ion cell production across different manufacturing levels.…
This study investigated the targeted antimicrobial effects of three photosensitizers—Rose Bengal (RB), methylene blue (MB), and porphyrin derivative (PD)—in photodynamic therapy (PDT) for the selective inactivation of microbial biofilms on…
Zinc sulfide (ZnS) nanomaterials have shown strong promise in the removal of elemental mercury (Hg⁰) from industrial flue gas, particularly in high-temperature environments typical of non-ferrous metal smelting. This study…
The pursuit of high-performance, lead-free optoelectronic materials has led to significant advances in semiconductors containing lone-pair ns² cations, where structural dimensionality plays a pivotal role in determining electronic properties and…
Human peptidylarginine deiminase type III (PAD3) is a key enzyme in the regulation of protein citrullination, a post-translational modification that alters protein charge, stability, and interactions. Expressed primarily in epidermal…
Inhibiting racemases and epimerases that operate via a 1,1-proton transfer mechanism is a promising strategy for treating diseases where these enzymes play critical roles in metabolism or pathogenesis. Effective inhibition…
The identification of a minimal, high-potency glucagon antagonist capable of sustained in vivo action represents a significant advancement in the development of therapeutics for acute hyperglycemic emergencies. This study focuses…
The therapeutic potential of the Pat-HBc/RSG&ZnPcS4 nanocomplex was rigorously evaluated in obese (Ob/Ob) mice over a two-week treatment regimen involving two cycles of intravenous administration followed by abdominal laser irradiation.…
The quest for high-performance optoelectronic materials has traditionally centered on chemical substitution within established perovskite frameworks. However, this study demonstrates that redefining the spatial arrangement of functional octahedral units can…
A 29-year-old male healthcare worker, previously healthy and without prior exposure to heparin, received the ChAdOx1 nCoV-19 adenoviral vector vaccine on March 29. Nine days later, he developed persistent headache…
The development of advanced biomaterials capable of mimicking the dynamic and heterogeneous nature of the extracellular matrix (ECM) is critical for next-generation cell culture systems. This study presents a modular…
The adsorption mechanism of Hg(II) on oxygen-containing MXene was systematically investigated through comprehensive characterization and kinetic modeling. The material’s high surface reactivity stems from the deliberate incorporation of oxygen functional…
The emergence and re-emergence of flaviviruses such as Zika virus (ZIKV), dengue virus (DENV), and yellow fever virus (YFV) continue to threaten global health, particularly in endemic regions like Brazil.…
Hydrogen-bonded supramolecular elastomers have emerged as a cornerstone in the development of next-generation wearable electronic devices, offering a unique combination of mechanical robustness, electrical functionality, and autonomous self-repair capability. These…
The rational design of single atom catalysts (SACs) with tailored electronic and geometric structures is essential for optimizing electrocatalytic performance in carbon dioxide reduction reactions (CO2RR). In this work, we…
The adsorption kinetics of benzopyrene (BaP) on granular activated carbon (GAC), biochar, and Haplic Chernozem soil were investigated to elucidate the underlying mechanisms governing contaminant retention in environmental systems. Batch…
The expression of programmed death-ligand 1 (PD-L1) in breast cancer is tightly regulated by a complex interplay of genetic, epigenetic, and signaling pathways that influence both tumor-intrinsic and immune-mediated mechanisms.…
The pursuit of advanced optical materials with ultrafast and tunable nonlinear optical (NLO) responses across a wide spectral range has long been a central goal in photonics and optoelectronics. In…
Layered transition metal oxides have emerged as promising candidates for potassium-ion (KIB) and sodium-ion (NIB) battery cathodes due to their high theoretical capacities, suitable working potentials, and scalable synthesis routes.…
Metal-organic frameworks (MOFs) have emerged as a promising class of microporous materials due to their high surface area, tunable pore size, and versatile functionality. These properties make them ideal candidates…
Inherited atherogenic dyslipidemias represent a group of monogenic disorders characterized by elevated levels of atherogenic lipoproteins, significantly increasing the risk of premature atherosclerotic cardiovascular disease (ASCVD). These conditions—familial hypercholesterolemia (FH),…
Liver fibrosis, a progressive pathological condition triggered by chronic liver injury, often leads to cirrhosis and hepatocellular carcinoma if left untreated. Early diagnosis is critical for effective intervention and improved…
Bristol-Myers Squibb (BMS)-derived indole-glyoxamide compounds, known as HIV entry inhibitors (ENIs), have been modified through strategic conjugation to polyol scaffolds such as β-cyclodextrin and hyperbranched polyglycerol (HPG) via click chemistry.…
The development of efficient and sustainable photocatalytic systems is critical for addressing persistent organic pollutants like tetracycline (TC) in aquatic environments. In this study, a novel hybrid photocatalyst, phosphorus-doped graphitic…
Product Name : Cathelicidin-1Brief Description : Recombinant ProteinAccession No. : Uniprot ID:Q6QLQ5Calculated MW : Target Sequence : Storage : Store at -20˚C. (Avoid repeated freezing and thawing.)Application Details : Storage…
Product Name : Chitinase-3-like protein 1Brief Description : Recombinant ProteinAccession No. : Uniprot ID:Q29411Calculated MW : Target Sequence : Storage : Store at -20˚C. (Avoid repeated freezing and thawing.)Application Details…
The success of metal-organic frameworks (MOFs) in analytical separations hinges critically on their ability to precisely control pore size and geometry, which govern molecular recognition, diffusion kinetics, and selectivity. By…
Product Name : Hematopoietic progenitor cell antigen CD34Brief Description : Recombinant ProteinAccession No. : Uniprot ID:Q28270Calculated MW : Target Sequence : Storage : Store at -20˚C. (Avoid repeated freezing and…
Product Name : C-C motif chemokine 28Brief Description : Recombinant ProteinAccession No. : Uniprot ID:Q9JIL2Calculated MW : Target Sequence : Storage : Store at -20˚C. (Avoid repeated freezing and thawing.)Application…
P-glycoprotein (Pgp), encoded by the ABCB1 gene, is a well-characterized efflux transporter responsible for multidrug resistance (MDR) in cancer cells. This study investigates the functional and molecular role of Pgp…
Product Name : Mast cell carboxypeptidase ABrief Description : Recombinant ProteinAccession No. : Uniprot ID:P21961Calculated MW : Target Sequence : Storage : Store at -20˚C. (Avoid repeated freezing and thawing.)Application…
The rational design and synthesis of metal-organic frameworks (MOFs) with well-controlled interpenetration represent a significant frontier in materials science, particularly for applications involving porosity and guest-host interactions. In this study,…
Product Name : Complement C1q tumor necrosis factor-related protein 1Brief Description : Recombinant ProteinAccession No. : Uniprot ID:Q9BXJ1Calculated MW : Target Sequence : Storage : Store at -20˚C. (Avoid repeated…
Product Name : BasiginBrief Description : Recombinant ProteinAccession No. : Uniprot ID:P26453Calculated MW : Target Sequence : Storage : Store at -20˚C. (Avoid repeated freezing and thawing.)Application Details : Storage…
Product Name : Aflatoxin B1 aldehyde reductase member 2Brief Description : Recombinant ProteinAccession No. : Uniprot ID:Q8CG45Calculated MW : Target Sequence : Storage : Store at -20˚C. (Avoid repeated freezing…
Product Name : Angiopoietin-1Brief Description : Recombinant ProteinAccession No. : Uniprot ID:O18920Calculated MW : Target Sequence : Storage : Store at -20˚C. (Avoid repeated freezing and thawing.)Application Details : Storage…
Product Name : Activity-dependent neuroprotector homeobox proteinBrief Description : Recombinant ProteinAccession No. : Uniprot ID:Q9H2P0Calculated MW : Target Sequence : Storage : Store at -20˚C. (Avoid repeated freezing and thawing.)Application…
Product Name : 14-3-3 protein zeta/deltaBrief Description : Recombinant ProteinAccession No. : Uniprot ID:P63103Calculated MW : Target Sequence : Storage : Store at -20˚C. (Avoid repeated freezing and thawing.)Application Details…
Product Name : C-telopeptide of Collagen alpha-1(I) chainBrief Description : Recombinant ProteinAccession No. : Uniprot ID:P02454Calculated MW : Target Sequence : Storage : Store at -20˚C. (Avoid repeated freezing and…
Product Name : Rab GDP dissociation inhibitor alphaBrief Description : Recombinant ProteinAccession No. : Uniprot ID:P21856Calculated MW : Target Sequence : Storage : Store at -20˚C. (Avoid repeated freezing and…
Name : Influenza A H1N1 (A/England/195/2009) Hemagglutinin Protein (HA1 Subunit) (His Tag) Biological Activity : Background : The influenza viral Hemagglutinin (HA) protein is a homotrimer with a receptor binding…
Name : Influenza A H1N1 (A/Puerto Rico/8/1934) Hemagglutinin / HA Protein (ECD, His Tag) Biological Activity : Background : The influenza viral Hemagglutinin (HA) protein is a homotrimer with a…
Product Name : Recombinant Human RUSC1Brief Description : Recombinant ProteinAccession No. : Swissprot:Q9BVN2Gene Accession:BC001045Calculated MW : Target Sequence : Storage : -20~-80˚C, pH 7.6 PBSApplication Details : Uniprot : Q9BVN2MedChemExpress…
Product Name : Recombinant Human BPIFB1Brief Description : Recombinant ProteinAccession No. : Swissprot:Q8TDL5Gene Accession:BC008429Calculated MW : Target Sequence : Storage : -20~-80˚C, pH 7.6 PBSApplication Details : Uniprot : Q8TDL5MedChemExpress…
Product Name : Recombinant Human CWF19L1Brief Description : Recombinant ProteinAccession No. : Swissprot:Q69YN2Gene Accession:BC008746Calculated MW : Target Sequence : Storage : -20~-80˚C, pH 7.6 PBSApplication Details : Uniprot : Q69YN2MedChemExpress…
Name : Recombinant Sus scrofa (Pig) Transferrin Protein (hFc Tag) Biological Activity : Background : Transferrin is a glycoprotein with an approximate molecular weight of 76.5 kDa. This glycoprotein is…
Product Name : Lauroylcholine chloride hydrateSynonym : N-trimethylammonium chlorideO-Lauroylcholine chlorideCholine laurate chlorideChemical Name : CAS NO.: 25234-60-0Molecular formula : C17H36ClNO2Molecular Weight: 321.93 g/molClassification : MedChemExpress Products > Research Chemicals >…
Name : SARS-CoV-2 (BA.4/BA.5/BA.5.2) Spike S1+S2 trimer Protein (ECD, His Tag) (HPLC-verified) Biological Activity : Background : The spike (S) glycoprotein of coronaviruses contains protrusions that will only bind to…
Product Name : Fusidic acidSynonym : (3a,4a,8a,9b,11a,13a,147b,167b,17Z)-16-(Acetyloxy)-3,11-dihydroxy-29-nordammara-17(20),24-dien-21-oic acidFlucidinFucithalmicChemical Name : CAS NO.: 6990-06-3Molecular formula : C31H48O6Molecular Weight: 516.71 g/molClassification : MedChemExpress Products > Antimicrobials > Antibiotics > Fusidic acidDescription: Inhibitor…
Product Name : Recombinant Human USF1Brief Description : Recombinant ProteinAccession No. : Swissprot:P22415Gene Accession:BC035505Calculated MW : Target Sequence : Storage : -20~-80˚C, pH 7.6 PBSApplication Details : Uniprot : P22415MedChemExpress…
Product Name : Z-Gly-Gly-Leu-AMCSynonym : Chemical Name : CAS NO.: 97792-39-7Molecular formula : C28H32N4O7Molecular Weight: 536.58 g/molClassification : MedChemExpress Products > Research Chemicals > Z-Gly-Gly-Leu-AMCDescription: Z-Gly-Gly-Leu-AMC is a small molecule…
Product Name : Recombinant Human TRIM35Brief Description : Recombinant ProteinAccession No. : Swissprot:Q9UPQ4Gene Accession:BC018337Calculated MW : Target Sequence : Storage : -20~-80˚C, pH 7.6 PBSApplication Details : Uniprot : Q9UPQ4MedChemExpress…
Product Name : NUC-7738Synonym : Chemical Name : CAS NO.: 2348493-39-8Molecular formula : C26H29N6O7PMolecular Weight: 568.5 g/molClassification : MedChemExpress Products > Impurities > NUC-7738Description: NUC-7738 is a medicinal compound that…
Product Name : 12-Oxocalanolide ASynonym : Chemical Name : CAS NO.: 161753-49-7Molecular formula : C22H24O5Molecular Weight: 368.4 g/molClassification : MedChemExpress Products > Natural Products > 12-Oxocalanolide ADescription: 12-Oxocalanolide A is…
Product Name : Recombinant Human JUPBrief Description : Recombinant ProteinAccession No. : Swissprot:P14923Gene Accession:BC011865Calculated MW : Target Sequence : Storage : -20~-80˚C, pH 7.6 PBSApplication Details : Uniprot : P14923MedChemExpress…
Product Name : Recombinant Human DMDBrief Description : Recombinant ProteinAccession No. : Swissprot:P11532Gene Accession:BC028720Calculated MW : Target Sequence : Storage : -20~-80˚C, pH 7.6 PBSApplication Details : Uniprot : P11532MedChemExpress…
Product Name : NVP-BVU972Synonym : Chemical Name : CAS NO.: 1185763-69-2Molecular formula : C20H16N6Molecular Weight: 340.39 g/molClassification : MedChemExpress Products > Life Sciences > NVP-BVU972Description: NVP-BVU972 is a small molecule…
Product Name : Recombinant Human CRKBrief Description : Recombinant ProteinAccession No. : Swissprot:P46108Gene Accession:BC009837Calculated MW : Target Sequence : Storage : -20~-80˚C, pH 7.6 PBSApplication Details : Uniprot : P46108MedChemExpress…
Product Name : MNI-caged-L-glutamateSynonym : Caged glutamateChemical Name : CAS NO.: 295325-62-1Molecular formula : C14H17N3O6Molecular Weight: 336.8 g/molClassification : MedChemExpress Products > Life Sciences > Ligands > Metabotropic Glutamate Receptors…
Product Name : Recombinant Human ZWINTBrief Description : Recombinant ProteinAccession No. : Swissprot:O95229Gene Accession:BC020979Calculated MW : Target Sequence : Storage : -20~-80˚C, pH 7.6 PBSApplication Details : Uniprot : O95229MedChemExpress…
Product Name : Hybridaphniphylline BSynonym : Chemical Name : CAS NO.: 1467083-09-5Molecular formula : C37H47NO11Molecular Weight: 681.8 g/molClassification : MedChemExpress Products > Natural Products > Hybridaphniphylline BDescription: Hybridaphniphylline B is…
Product Name : Recombinant Human DCTBrief Description : Recombinant ProteinAccession No. : Swissprot:P40126Gene Accession:BC028311Calculated MW : Target Sequence : Storage : -20~-80˚C, pH 7.6 PBSApplication Details : Uniprot : P40126MedChemExpress…
Product Name : m-dPEG®24-MALSynonym : Chemical Name : CAS NO.: 88504-24-9Molecular formula : C22H39 F3N4O7 SMolecular Weight: 560.63 g/molClassification : MedChemExpress Products > Life Sciences > m-dPEG®24-MALDescription: m-dPEG®24-MAL is a…
Product Name : Recombinant Human SELPLGBrief Description : Recombinant ProteinAccession No. : Swissprot:Q14242Gene Accession:BC029782Calculated MW : Target Sequence : Storage : -20~-80˚C, pH 7.6 PBSApplication Details : Uniprot : Q14242MedChemExpress…
Product Name : Chk2 Inhibitor IISynonym : Chemical Name : CAS NO.: 516480-79-8Molecular formula : C20H14ClN3O2Molecular Weight: 363.8 g/molClassification : MedChemExpress Products > Research Chemicals > Chk2 Inhibitor IIDescription: Chk2…
Product Name : Recombinant Human Interleukin-37,IL-37Brief Description : Accession No. : Q9NZH6.2Calculated MW : 18.7kDaTarget Sequence : MKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSDStorage : Lyophilized protein should be stored at Reconstituted protein solution can be…
Product Name : Cardiogenol CSynonym : Chemical Name : CAS NO.: 671225-39-1Molecular formula : C13H16N4O2Molecular Weight: 260.29 g/molClassification : MedChemExpress Products > Research Chemicals > Cardiogenol CDescription: Cardiogenol C is…
Product Name : Recombinant Human IRF6Brief Description : Recombinant ProteinAccession No. : Swissprot:O14896Gene Accession:BC014852Calculated MW : Target Sequence : Storage : -20~-80˚C, pH 7.6 PBSApplication Details : Uniprot : O14896MedChemExpress…
Product Name : rac-Terpinen-4-olSynonym : 4-Methyl-1-(1-methylethyl)-3-cyclohexen-1-olp-Menth-1-en-4-olChemical Name : CAS NO.: 562-74-3Molecular formula : C10H18OMolecular Weight: 154.25 g/molClassification : MedChemExpress Products > Research Chemicals > rac-Terpinen-4-olDescription: Terpinen-4-ol is a natural compound…
Product Name : Recombinant Human GDNFBrief Description : Recombinant ProteinAccession No. : Swissprot:P48540Gene Accession:BC069369Calculated MW : Target Sequence : Storage : -20~-80˚C, pH 7.6 PBSApplication Details : Uniprot : P48540MedChemExpress…
Product Name : FSL-1Synonym : Chemical Name : CAS NO.: 322455-70-9Molecular formula : C84H140N14O18SMolecular Weight: 1,666.2 g/molClassification : MedChemExpress Products > Life Sciences > Ligands > FSL-1Description: FSL-1 is an…
Product Name : Recombinant Human CAPN7Brief Description : Recombinant ProteinAccession No. : Swissprot:Q9Y6W3Gene Accession:BC056202Calculated MW : Target Sequence : Storage : -20~-80˚C, pH 7.6 PBSApplication Details : Uniprot : Q9Y6W3MedChemExpress…
Product Name : RamoplaninSynonym : Chemical Name : CAS NO.: 76168-82-6Molecular formula : C119H156ClN21O40Molecular Weight: 2,556.08 g/molClassification : MedChemExpress Products > Research Chemicals > RamoplaninDescription: Ramoplanin is an antibiotic that…
Product Name : IL-2(human)Superkine(Fc)Brief Description : 1545096460Accession No. : Calculated MW : Target Sequence : Storage : Application Details : Uniprot : MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth…
Product Name : 9-Hydroxyellipticine HydrochlorideSynonym : Chemical Name : CAS NO.: 52238-35-4Molecular formula : C17H14N2O•HClMolecular Weight: 262.31 g/molClassification : MedChemExpress Products > Research Chemicals > 9-Hydroxyellipticine HydrochlorideDescription: 9-Hydroxyellipticine Hydrochloride is…
Product Name : MacrosialinBrief Description : Recombinant ProteinAccession No. : P31996Gene name:Cd68Calculated MW : 29.81Target Sequence : Storage : Store at -20C. (Avoid repeated freezing and thawing.)Repeated freezing and thawing…
Product Name : MG 624Synonym : Chemical Name : CAS NO.: 77257-42-2Molecular formula : C22H30INOMolecular Weight: 451.38 g/molClassification : MedChemExpress Products > Life Sciences > Ligands > MG 624Description: MG…
Product Name : Apoptosis-associated speck-like protein containing a CARDBrief Description : Recombinant ProteinAccession No. : Q9ULZ3Gene name:PYCARDCalculated MW : 21.45Target Sequence : Storage : Store at -20C. (Avoid repeated freezing…
Product Name : Taurodeoxychloic acidSynonym : Chemical Name : CAS NO.: 516-50-7Molecular formula : C26H45NO6SMolecular Weight: 499.7 g/molClassification : MedChemExpress Products > Research Chemicals > Taurodeoxychloic acidDescription: Taurodeoxycholic acid (TDCA)…
Product Name : Recombinant Human Ly6,PLAUR Domain-Containing Protein 3,LYPD3,C4.4A (C-6His)Brief Description : Accession No. : O95274Calculated MW : 27.89kDaTarget Sequence : LECYSCVQKADDGCSPNKMKTVKCAPGVDVCTEAVGAVETIHGQFSLAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNLTSRALDPAGNESAYPPNGVECYSCVGLSREACQGTSPPVVSCYNASDHVYKGCFDGNVTLTAANVTVSLPVRGCVQDEFCTRDGVTGPGFTLSGSCCQGSRCNSDLRNKTYFSPRIPPLVRLPPPEPTTVASTTSVTTSTSAPVRPTSTTKPMPAPTSQTPRQGVEHVDHHHHHHStorage : Lyophilized protein should be stored at Reconstituted…
Product Name : Triethylene glycolSynonym : Chemical Name : CAS NO.: 112-27-6Molecular formula : C6H14O4Molecular Weight: 150.17 g/molClassification : MedChemExpress Products > Research Chemicals > Triethylene glycolDescription: Triethylene glycol is…
Product Name : N-glycosylase/DNA lyaseBrief Description : Recombinant ProteinAccession No. : O15527Gene name:OGG1Calculated MW : 16.5Target Sequence : Storage : Store at -20C. (Avoid repeated freezing and thawing.)Repeated freezing and…
Product Name : Starch from potatoSynonym : Chemical Name : CAS NO.: 9005-25-8Molecular formula : Molecular Weight: Classification : MedChemExpress Products > Carbohydrates > Polysaccharides > Polysaccharides from Higher Plants…
Product Name : Tachykinin-3Brief Description : Recombinant ProteinAccession No. : Q9UHF0Gene name:TAC3Calculated MW : Target Sequence : Storage : Store at -20C. (Avoid repeated freezing and thawing.)Repeated freezing and thawing…
Product Name : DencichineSynonym : Chemical Name : CAS NO.: 5302-45-4Molecular formula : C5H8N2O5Molecular Weight: 176.13 g/molClassification : MedChemExpress Products > Research Chemicals > DencichineDescription: Dencichine is an anti-inflammatory and…
Product Name : Coagulation factor XIBrief Description : Recombinant ProteinAccession No. : P03951Gene name:F11Calculated MW : 26.18Target Sequence : Storage : Store at -20C. (Avoid repeated freezing and thawing.)Repeated freezing…
Product Name : 1,2-O-Isopropylidene-a-D-xylofuranoseSynonym : 1,2-O-(1-Methylethylidene)-a-D-xylofuranoseMAXChemical Name : CAS NO.: 20031-21-4Molecular formula : C8H14O5Molecular Weight: 190.19 g/molClassification : MedChemExpress Products > Carbohydrates > Monosaccharides > 1,2-O-Isopropylidene-a-D-xylofuranoseDescription: Chiral building block for…
Product Name : Beta-defensin 1Brief Description : Recombinant ProteinAccession No. : P60022Gene name:DEFB1Calculated MW : 3.96Target Sequence : Storage : Store at -20C. (Avoid repeated freezing and thawing.)Repeated freezing and…
Product Name : DecachlorobiphenylSynonym : Chemical Name : CAS NO.: 2051-24-3Molecular formula : C12Cl10Molecular Weight: 498.66 g/molClassification : MedChemExpress Products > Controlled Products > DecachlorobiphenylDescription: Decachlorobiphenyl is a chemical that…
Product Name : Recombinant Human Fibroblast Growth Factor 2,FGF-2,FGFb (Gly132-Ser288)Brief Description : Accession No. : P09038Calculated MW : 16.4kDaTarget Sequence : GTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKSStorage : Lyophilized protein should be stored at Reconstituted…
Product Name : Eupalinilide-DSynonym : Chemical Name : CAS NO.: 757202-14-5Molecular formula : C15H19ClO5Molecular Weight: 314.76 g/molClassification : MedChemExpress Products > Life Sciences > Eupalinilide-DDescription: Eupalinilide-D is a peptide inhibitor…
Product Name : Recombinant Human T-lymphocyte activation antigen CD80(CD80)Brief Description : Recombinant ProteinAccession No. : P33681Calculated MW : 32.8 kDaTarget Sequence : VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNLLPSWAITLISVNGIFVICCLTYCFAPRCRERRRNERLRRESVRPVStorage : The shelf life is related to…
Product Name : GriffonilideSynonym : Chemical Name : CAS NO.: 61371-55-9Molecular formula : Molecular Weight: Classification : MedChemExpress Products > Research Chemicals > GriffonilideDescription: Griffonilide is a plant-derived natural product…
Product Name : Recombinant Salmonella enterica I Flagellin(fljB)Brief Description : Recombinant ProteinAccession No. : E7CIA8Calculated MW : 52.3 kDaTarget Sequence : MAQVINTNSLSLLTQNNLNKSQSALGTAIERLSSGLRINSAKDDAAGQAIANRFTANIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQRLNEIDRVSGQTQFNGVKVLAQDNTLTIQVGANDGETIDIDLKQINSQTLGLDSLNVQKAYDVSATDVISSTYSDGTQALTAPTATEIKAALGNPTVTGDTLTATVSFKDGKYYATVGGYTDAGDTAKNGKYEVTVDSATGAVSFGATPTKSTVTGDTAVTKVQVNAPVPVAADAATKKALQDGGVSSADASAATLVKMSYTDKNGKTIEGGYALKAGDKYYAADYDEATGAIKAKTTSYTAADGTTKTAANQLGGVDGKTEVVTIDGKTYNASKAAGHDFKAQPELAEAAAKTTENPLQKIDAALAQVDALRSDLGAVQNRFNSAITNLGNTVNNLSEARSRIEDSDYATEVSNMSRAQILQQAGTSVLAQANQVPQNVLSLLRStorage : The shelf life is related to many…
Product Name : Recombinant Rat Vitamin K-dependent protein C(Proc)Brief Description : Recombinant ProteinAccession No. : P31394Calculated MW : 49.3 kDaTarget Sequence : ANSFLEEVRAGSLERECMEEICDFEEAQEIFQNVEDTLAFWIKYFDGDQCSTPPLDHQCDSPCCGHGTCIDGLGGFSCSCDKGWEGRFCQQEMGFQDCRVKNGGCYHYCLEETRGRRCRCAPGYELADDHMHCRPTVNFPCGKLWKRTDKKRKNFKRDIDPEDEELELGPRIVNGTLTKQGDSPWQAILLDSKKKLACGGVLIHTSWVLTAAHCLESSKKLTVRLGEYDLRRRDPWELDLDIKEVLVHPNYTRSNSDNDIALLRLSQPATLSKTIVPICLPNSGLAQELSQAGQETVVTGWGYQSDKVKDGRRNRTFILTFIRIPLAARNDCMQVMNNVVSENMLCAGIIGDTRDACDGDSGGPMVVFFRGTWFLVGLVSWGEGCGHLNNYGVYTKVGSYLKWIHSYIGERDVSLKSPKLStorage : The shelf life is related to…
Product Name : Recombinant Zaire ebolavirus Nucleoprotein(NP),partialBrief Description : Recombinant ProteinAccession No. : P18272Calculated MW : 45.1 kDaTarget Sequence : LDEDDEDTKPVPNRSTKGGQQKNSQKGQHIEGRQTQSRPIQNVPGPHRTIHHASAPLTDNDRRNEPSGSTSPRMLTPINEEADPLDDADDETSSLPPLESDDEEQDRDGTSNRTPTVAPPAPVYRDHSEKKELPQDEQQDQDHTQEARNQDSDNTQSEHSFEEMYRHILRSQGPFDAVLYYHMMKDEPVVFSTSDGKEYTYPDSLEEEYPPWLTEKEAMNEENRFVTLDGQQFYWPVMNHKNKFMAILQHHQStorage : The shelf life is related to many factors,…
Product Name : Recombinant Mycobacterium tuberculosis Adenylate kinase(adk)Brief Description : Recombinant ProteinAccession No. : A5U0B9Calculated MW : 36.1 kDaTarget Sequence : MRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGTKLGVEAKRYLDAGDLVPSDLTNELVDDRLNNPDAANGFILDGYPRSVEQAKALHEMLERRGTDIDAVLEFRVSEEVLLERLKGRGRADDTDDVILNRMKVYRDETAPLLEYYRDQLKTVDAVGTMDEVFARALRALGKStorage : The shelf life is related to many…
Product Name : Recombinant Human Immunoglobulin J chain(JCHAIN)Brief Description : Recombinant ProteinAccession No. : P01591Calculated MW : 20.6 kDaTarget Sequence : QEDERIVLVDNKCKCARITSRIIRSSEDPNEDIVERNIRIIVPLNNRENISDPTSPLRTRFVYHLSDLCKKCDPTEVELDNQIVTATQSNICDEDSATETCYTYDRNKCYTAVVPLVYGGETKMVETALTPDACYPDStorage : The shelf life is related to many…
Product Name : Recombinant Outer-membrane lipoprotein carrier proteinBrief Description : Recombinant ProteinAccession No. : A7ZYJ5Calculated MW : 22.3 kDaTarget Sequence : DAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINVGRDGTIHQFSAVEQDDQRSSYQLKSQQNGAVDAAKFTFTPPQGVTVDDQRKStorage : The shelf life is related to many…
Product Name : Phosphoglucomutase-1Brief Description : Recombinant ProteinAccession No. : Uniprot ID:P36871Calculated MW : Target Sequence : Storage : Store at -20˚C. (Avoid repeated freezing and thawing.)Application Details : Storage…
Product Name : Vasopressin-neurophysin 2-copeptinBrief Description : Recombinant ProteinAccession No. : Uniprot ID:P01186Calculated MW : Target Sequence : Storage : Store at -20˚C. (Avoid repeated freezing and thawing.)Application Details :…
Product Name : Coagulation factor XIIBrief Description : Recombinant ProteinAccession No. : Uniprot ID:P98140Calculated MW : Target Sequence : Storage : Store at -20˚C. (Avoid repeated freezing and thawing.)Application Details…
Product Name : Recombinant Human BCAT2Brief Description : Recombinant ProteinAccession No. : Swissprot:O15382Gene Accession:BC001900Calculated MW : Target Sequence : Storage : -20~-80˚C, pH 7.6 PBSApplication Details : Uniprot : O15382MedChemExpress…
Product Name : Recombinant Human Syndecan-1/CD138 ProteinBrief Description : Accession No. : Calculated MW : The protein has a calculated MW of 23.9 kDa, containing 232 amino acids. The protein…
Product Name : Recombinant Human Granulocyte Colony Stimlating Factor (rHu G-CSF)Brief Description : Recombinant ProteinAccession No. : accession:P60568 GeneID:3558Calculated MW : Approximately 15.4 kDa, a singTarget Sequence : APTSSSTKKT QLQLEHLLLD…
Product Name : Recombinant Bovine Enterokinase Light Chain, HisBrief Description : Accession No. : Calculated MW : Approximately 28 kDa, a single non-glycosylated polypeptide chain containing 241 amino acids，with 6…
Product Name : Recombinant Murine PersephinBrief Description : Accession No. : Calculated MW : Approximately 20.7 kDa, a disulfide-linked homodimer of two 96 amino acid polypeptide chains.Target Sequence : ALAGSCRLWS…
Product Name : Recombinant Human B-cell CLL/lymphoma 7 protein family member A(BCL7A)Brief Description : Recombinant ProteinAccession No. : Q4VC05Calculated MW : Target Sequence : 1-210 full length protein MSGRSVRAET RSRAKDDIKR…
Product Name : Recombinant Human Proepiregulin(EREG),partialBrief Description : Recombinant ProteinAccession No. : O14944Calculated MW : 22.9 kDaTarget Sequence : VAQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFLTVHQPLSKEYVStorage : The shelf life is related to many factors, storage…
Product Name : Recombinant Vaccinia virus Cell surface-binding protein (D8L)Brief Description : Recombinant ProteinAccession No. : P20508Calculated MW : 51.3 kDaTarget Sequence : MPQQLSPINIETKKAISNARLKPLDIHYNESKPTTIQNTGKLVRINFKGGYISGGFLPNEYVLSSLHIYWGKEDDYGSNHLIDVYKYSGEINLVHWNKKKYSSYEEAKKHDDGLIIISIFLQVSDHKNVYFQKIVNQLDSIRSANTSAPFDSVFYLDNLLPSTLDYFTYLGTTIKHSADAVWIIFPTPINIHSDQLSKFRTLLSSSNHDGKPYYITENYRNPYKLNDDTQVYYSGEIIRAATTSPARENYFMRWLSDLRETCFSYYQKYIEGNKTFAIIAIVFVFILTAILFLMSRRYSREKQNStorage : The shelf life is related…
Product Name : Recombinant Pig Antibacterial peptide PMAP-36(PMAP36)Brief Description : Recombinant ProteinAccession No. : P49931Calculated MW : 20.3 kDaTarget Sequence : VGRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCGStorage : The shelf life is related to many…
Name : Recombinant Human ACE2, C-FcBackground : Background : Biological Activity : Species : HumanExpression System : Protein Accession : Q9BYF1Synonyms : Recombinant Human ACE2, C-FcAmino Acid Sequence : Molecular…
Product Name : Recombinant Rickettsia japonica 17 kDa surface antigen(omp)Brief Description : Recombinant ProteinAccession No. : Q52764Calculated MW : 30.5 kDaTarget Sequence : CNGPGGMNKQGTGTLLGGAGGALLGSQFGKGTGQLVGVGVGALLGAVLGGQIGAGMDEQDRRLAELTSQRALETAPSGSNVEWRNPDNGNYGYVTPNKTYRNSTGQYCREYTQTVVIGGKQQKAYGNACRQPDGQWQVVNStorage : The shelf life is related…
Name : Recombinant Human ACE2, C-HisBackground : Background : Biological Activity : Species : HumanExpression System : Protein Accession : Q9BYF1Synonyms : Recombinant Human ACE2, C-HisAmino Acid Sequence : Molecular…
Product Name : Recombinant Replication initiation protein(repD)Brief Description : Recombinant ProteinAccession No. : P03065Calculated MW : 53.5 kDaTarget Sequence : MSTENHSNYLQNKDLDNFSKTGYSNSRLSGNFFTTPQPELSFDAMTIVGNLNKTNAKKLSDFMSTEPQIRLWDILQTKFKAKALQEKVYIEYDKVKADSWDRRNMRVEFNPNKLTHEEMLWLKQNIIDYMEDDGFTRLDLAFDFEDDLSDYYAMTDKAVKKTIFYGRNGKPETKYFGVRDSDRFIRIYNKKQERKDNADVEVMSEHLWRVEIELKRDMVDYWNDCFDDLHILKPDWTTPEKVKEQAMVYLLLNEEGTWGKLERHAKYKYKQLIKEISPIDLTELMKSTLKENEKQLQKQIDFWQREFRFWKStorage : The shelf life is related to many factors,…
Name : Recombinant Mouse CNDP2 protein ,C- His TagBackground : Background : Biological Activity : Species : Mus musculus (Mouse)Expression System : Protein Accession : Q9D1A2Synonyms : Recombinant Mouse CNDP2…
Product Name : Recombinant Human Mitochondrial carnitine,acylcarnitine carrier protein(SLC25A20)Brief Description : Recombinant ProteinAccession No. : O43772Calculated MW : 59.9 kDaTarget Sequence : MADQPKPISPLKNLLAGGFGGVCLVFVGHPLDTVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREGITGLYRGMAAPIIGVTPMFAVCFFGFGLGKKLQQKHPEDVLSYPQLFAAGMLSGVFTTGIMTPGERIKCLLQIQASSGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNIFTPEGKRVSELSAPRILVAGGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIRDEGVTSLYKGFNAVMIRAFPANAACFLGFEVAMKFLNWATPNLStorage : The shelf life is related to…
Name : Recombinant Human CD191/CCR1 Protein, N-HisBackground : Background : Biological Activity : Species : HumanExpression System : Protein Accession : P32246Synonyms : Recombinant Human CD191/CCR1 Protein, N-HisAmino Acid Sequence…
Product Name : Recombinant Human C-C motif chemokine 22 protein(CCL22)Brief Description : Recombinant ProteinAccession No. : O00626Calculated MW : 8.1 kDaTarget Sequence : GPYGANMEDS VCCRDYVRYR LPLRVVKHFY WTSDSCPRPG VVLLTFRDKE ICADPRVPWV KMILNKLSQStorage…
Product Name : Recombinant Human Tumor suppressor candidate 2(TUSC2)Brief Description : Recombinant ProteinAccession No. : O75896Calculated MW : 38.9 kDaTarget Sequence : GASGSKARGLWPFASAAGGGGSEAAGAEQALVRPRGRAVPPFVFTRRGSMFYDEDGDLAHEFYEETIVTKNGQKRAKLRRVHKNLIPQGIVKLDHPRIHVDFPVILYEVStorage : The shelf life is related to…
Name : Recombinant Human IL36A/IL-1F6, N-HisBackground : Background : Biological Activity : Species : HumanExpression System : Protein Accession : Q9UHA7Synonyms : Recombinant Human IL36A/IL-1F6, N-HisAmino Acid Sequence : Molecular…
Product Name : Recombinant Streptomyces avidinii Streptavidin proteinBrief Description : Recombinant ProteinAccession No. : P22629Calculated MW : 18.5 kDaTarget Sequence : DPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQStorage : The shelf life is related to many…
Name : Recombinant Human TAC3, N-HisBackground : Background : Biological Activity : Species : HumanExpression System : Protein Accession : Q9UHF0Synonyms : Recombinant Human TAC3, N-HisAmino Acid Sequence : Molecular…
Product Name : Recombinant mouse Major urinary protein 2Brief Description : Recombinant ProteinAccession No. : P11589Calculated MW : 20.7 kDaTarget Sequence : EEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLEKSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAKLCEEHGILRENIIDLSNANRCLQAREStorage : The shelf life is related to…
Name : Recombinant Human TP63, N-HisBackground : Background : Biological Activity : Species : HumanExpression System : Protein Accession : Q9H3D4Synonyms : Recombinant Human TP63, N-HisAmino Acid Sequence : Molecular…
Product Name : Recombinant Human Protein disulfide-isomeraseBrief Description : Recombinant ProteinAccession No. : P07237Calculated MW : 57.3 kDaTarget Sequence : DAPEEEDHVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLPDGAAAESLVESSEVAVIGFFKDVESDSAKQFLQAAEAIDDIPFGITSNSDVFSKYQLDKDGVVLFKKFDEGRNNFEGEVTKENLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKTAAESFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESEELTAERITEFCHRFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQKAVKDELStorage : The shelf life is related to many factors,…
Name : Recombinant Human BMF, N-HisBackground : Background : Biological Activity : Species : HumanExpression System : Protein Accession : Q96LC9Synonyms : Recombinant Human BMF, N-HisAmino Acid Sequence : Molecular…
Product Name : Recombinant Human Amino-terminal enhancer of split(AES)Brief Description : Recombinant ProteinAccession No. : Q08117Calculated MW : 56.1 kDaTarget Sequence : MCHKNGFPQEGGITAAFLQKRKLRLSKNHRPARAKVTEHVRGTRPGRATAGPAASTRAAGSLFFDRWGNRGPAGCRGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEKSEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNGICAQVLPYLSQEHQQQVLGAIERAKQVTAPELNSIIRQQLQAHQLSQLQALALPLTPLPVGLQPPSLPAVSAGTGLLSLSALGSQAHLSKEDKNGHDGDTHQEDDGEKSDStorage : The shelf life is related to…
Name : Recombinant Human IL28B/IL28C/IFNL3, N-HisBackground : Background : Biological Activity : Species : HumanExpression System : Protein Accession : Q8IZI9Synonyms : Recombinant Human IL28B/IL28C/IFNL3, N-HisAmino Acid Sequence : Molecular…
Product Name : Recombinant human GTPase KRasBrief Description : Recombinant ProteinAccession No. : P01116Calculated MW : 23.1 kDaTarget Sequence : TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLStorage : The shelf life is related to many factors,…
Name : Recombinant Human NFE2L2, N-HisBackground : Background : Biological Activity : Species : HumanExpression System : Protein Accession : Q16236Synonyms : Recombinant Human NFE2L2, N-HisAmino Acid Sequence : Molecular…
Product Name : Recombinant human Peptidyl-prolyl cis-trans isomerase ABrief Description : Recombinant ProteinAccession No. : P62937Calculated MW : 17.9 kDaTarget Sequence : VNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLEStorage : The shelf life is related to…
Name : Recombinant Human PAPPA, N-HisBackground : Background : Biological Activity : Species : HumanExpression System : Protein Accession : Q13219Synonyms : Recombinant Human PAPPA, N-HisAmino Acid Sequence : Molecular…
Product Name : Recombinant human 60S ribosomal protein L3Brief Description : Recombinant ProteinAccession No. : P39023Calculated MW : 55.4 kDaTarget Sequence : SHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDPSKPVHLTAFLGYKAGMTHIVREVDRPGSKVNKKEVVEAVTIVETPPMVVVGIVGYVETPRGLRTFKTVFAEHISDECKRRFYKNWHKSKKKAFTKYCKKWQDEDGKKQLEKDFSSMKKYCQVIRVIAHTQMRLLPLRQKKAHLMEIQVNGGTVAEKLDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKLPRKTHRGStorage : The shelf life is related to…
Name : Recombinant Human CD300c, N-HisBackground : Background : Biological Activity : Species : HumanExpression System : Protein Accession : Q08708Synonyms : Recombinant Human CD300c, N-HisAmino Acid Sequence : Molecular…
Name : Recombinant Human PSMD4, N-GSTBackground : Background : Biological Activity : Species : HumanExpression System : Protein Accession : P55036Synonyms : Recombinant Human PSMD4, N-GSTAmino Acid Sequence : Molecular…
Product Name : Human NTB-A Protein, mFc-His TagBrief Description : Accession No. : Calculated MW : 50.1 kDaTarget Sequence : Storage : Store at -80˚C for 12 months (Avoid repeated…
Name : Recombinant Human FASN, N-HisBackground : Background : Biological Activity : Species : HumanExpression System : Protein Accession : P49327Synonyms : Recombinant Human FASN, N-HisAmino Acid Sequence : Molecular…
Product Name : Recombinant Rat Lymphotactin protein(Xcl1) (Active)Brief Description : Recombinant ProteinAccession No. : Calculated MW : Target Sequence : Storage : The shelf life is related to many factors,…
Product Name : Recombinant rat Type III iodothyronine deiodinaseBrief Description : Recombinant ProteinAccession No. : P49897Calculated MW : 31.5 kDaTarget Sequence : DFLCIRKHFLRRRHPDHPEPEVELNSEGEEMPPDDPPICVSDDNRLCTLASLKAVWHGQKLDFFKQAHEGGPAPNSEVVRPDGFQSQRILDYAQGTRPLVLNFGSCTUPPFMARMSAFQRLVTKYQRDVDFLIIYIEEAHPSDGWVTTDSPYVIPQHRSLEDRVSAARVLQQGAPGCALVLDTMANSSSSAYGAYFERLYVIQSGTIMYQGGRGPDGYQVSELRTWLERYDEQLHGTRPRRLStorage : The shelf life is related to…
Name : Recombinant Human MARCKS, N-HisBackground : Background : Biological Activity : Species : HumanExpression System : Protein Accession : P29966Synonyms : Recombinant Human MARCKS, N-HisAmino Acid Sequence : Molecular…
Product Name : Recombinant human Zinc finger protein 212Brief Description : Recombinant ProteinAccession No. : Q9UDV6Calculated MW : 71.4 kDaTarget Sequence : MAESAPARHRRKRRSTPLTSSTLPSQATEKSSYFQTTEISLWTVVAAIQAVEKKMESQAARLQSLEGRTGTAEKKLADCEKMAVEFGNQLEGKWAVLGTLLQEYGLLQRRLENVENLLRNRNFWILRLPPGSKGEAPKVSRSLENDGVCFTEQEWENLEDWQKELYRNVMESNYETLVSLKVLGQTEGEAELGTEMLGDLEEEGPGGAHPAGGVMIKQELQYTQEGPADLPGEFSCIAEEQAFLSPEQTELWGGQGSSVLLETGPGDSTLEEPVGSRVPSSSRTVGCPKQKSHRQVQLDQECGQGLKLKKDTSRPYECSECEITFRYKQQLATHLRSHSGWGSCTPEEPEESLRPRPRLKPQTKKAKLHQCDVCLRSFSCKVSLVTHQRCHLQEGPSAGQHVQERFSPNSLVALPGHIPWRKSRSSLICGYCGKSFSHPSDLVRHQRIHTGERPYSCTECEKSFVQKQHLLQHQKIHQRERGGLALEPGRPNGLLStorage : The shelf life is related to…
Name : Recombinant Human LORICRIN, N-GSTBackground : Background : Biological Activity : Species : HumanExpression System : Protein Accession : P23490Synonyms : Recombinant Human LORICRIN, N-GSTAmino Acid Sequence : Molecular…
Product Name : Recombinant Chikungunya virus Non-structural polyproteinPartialBrief Description : Recombinant ProteinAccession No. : Q8JUX6Calculated MW : 31.1 kDaTarget Sequence : DTVLETDIASFDKSQDDSLALTALMLLEDLGVDHSLLDLIEAAFGEISSCHLPTGTRFKFGAMMKSGMFLTLFVNTLLNITIASRVLEDRLTKSACAAFIGDDNIIHGVVSDELMAARCATWMNMEVKIIDAVVSQKAPYFCGGFILHDIVTGTACRVADPLKRLFKLGKPLAAGDEQDEDRRRALADEVVRWQRTGLIDELEKAVYSRYEVQGISVVVMSMATFASSRSNFEKLRGPVVTLYGGPKStorage : The shelf life is related to many…
Name : Recombinant Human CKMT2, N-HisBackground : Background : Biological Activity : Species : HumanExpression System : Protein Accession : P17540Synonyms : Recombinant Human CKMT2, N-HisAmino Acid Sequence : Molecular…
Product Name : Recombinant Sheep Interleukin-4(IL4)Brief Description : Recombinant ProteinAccession No. : P30368Calculated MW : 29.6 kDaTarget Sequence : HKCDITLEEIIKTLNILTSRKNSCMELPVADVFAAPKNATEKETFCRAGIELRRIYRSHMCLNKFLGGLDRNLSSLASKTCSVNEAKTSTSTLRDLLERLKTIMREKYSKCStorage : The shelf life is related to many factors, storage…
Name : Recombinant Human Adiponectin/Acrp30 protein ,C- His TagBackground : Background : Biological Activity : Species : Homo sapiens (Human)Expression System : Protein Accession : Q15848Synonyms : Recombinant Human Adiponectin/Acrp30…
Product Name : Recombinant mouse Importin subunit beta-1Brief Description : Recombinant ProteinAccession No. : P70168Calculated MW : 101.2 kDaTarget Sequence : MELITILEKTVSPDRLELEAAQKFLERAAVENLPTFLVELSRVLANPGNSQVARVAAGLQIKNSLTSKDPDIKAQYQQRWLAIDANARREVKNYVLQTLGTETYRPSSASQCVAGIACAEIPVSQWPELIPQLVANVTNPNSTEHMKESTLEAIGYICQDIDPEQLQDKSNEILTAIIQGMRKEEPSNNVKLAATNALLNSLEFTKANFDKESERHFIMQVVCEATQCPDTRVRVAALQNLVKIMSLYYQYMETYMGPALFAITIEAMKSDIDEVALQGIEFWSNVCDEEMDLAIEASEAAEQGRPPEHTSKFYAKGALQYLVPILTQTLTKQDENDDDDDWNPCKAAGVCLMLLSTCCEDDIVPHVLPFIKEHIKNPDWRYRDAAVMAFGSILEGPEPNQLKPLVIQAMPTLIELMKDPSVVVRDTTAWTVGRICELLPEAAINDVYLAPLLQCLIEGLSAEPRVASNVCWAFSSLAEAAYEAADVADDQEEPATYCLSSSFELIVQKLLETTDRPDGHQNNLRSSAYESLMEIVKNSAKDCYPAVQKTTLVIMERLQQVLQMESHIQSTSDRIQFNDLQSLLCATLQNVLRKVQHQDALQISDVVMASLLRMFQSTAGSGGVQEDALMAVSTLVEVLGGEFLKYMEAFKPFLGIGLKNYAEYQVCLAAVGLVGDLCRALQSNILPFCDEVMQLLLENLGNENVHRSVKPQILSVFGDIALAIGGEFKKYLEVVLNTLQQASQAQVDKSDFDMVDYLNELRESCLEAYTGIVQGLKGDQENVHPDVMLVQPRVEFILSFIDHIAGDEDHTDGVVACAAGLIGDLCTAFGKDVLKLVEARPMIHELLTEGRRSKTNKAKTLATWATKELRKLKNQAStorage : The shelf life is related to many…
Name : Recombinant Human SFTPB, N-HisBackground : Background : Biological Activity : Species : HumanExpression System : Protein Accession : P07988Synonyms : Recombinant Human SFTPB, N-HisAmino Acid Sequence : Molecular…
Product Name : Recombinant human Ephrin-A1Brief Description : Recombinant ProteinAccession No. : P20827Calculated MW : 35.4 kDaTarget Sequence : DRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHSIGHSStorage : The shelf life is related to many factors, storage…
Name : Recombinant Human CKMB/CK-MB protein ,C- Strep tag & N- His TagBackground : Background : Biological Activity : Species : Homo sapiens (Human)Expression System : Protein Accession : P06732…
Product Name : Recombinant human Aquaporin-1Brief Description : Recombinant ProteinAccession No. : P29972Calculated MW : 21.6 kDaTarget Sequence : GALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPKStorage : The shelf life is related to many factors, storage…
Name : Recombinant Human LEFTY1, N-HisBackground : Background : Biological Activity : Species : HumanExpression System : Protein Accession : O75610Synonyms : Recombinant Human LEFTY1, N-HisAmino Acid Sequence : Molecular…
Product Name : SARS-CoV-2 (2019-nCoV) Spike Protein (S1+S2 ECD, His tag)Brief Description : Recombinant ProteinsAccession No. : Calculated MW : 134.36 kDa.Target Sequence : Storage : Samples are stable for…
Name : Recombinant Human AIM2, N-HisBackground : Background : Biological Activity : Species : HumanExpression System : Protein Accession : O14862Synonyms : Recombinant Human AIM2, N-HisAmino Acid Sequence : Molecular…
Product Name : Cytoplasmic tyrosine-protein kinase BMXBrief Description : Recombinant ProteinAccession No. : Uniprot ID:P51813Calculated MW : Target Sequence : Storage : Store at -20˚C. (Avoid repeated freezing and thawing.)Application…
Name : Recombinant Human QSOX1, N-HisBackground : Background : Biological Activity : Species : HumanExpression System : Protein Accession : O00391Synonyms : Recombinant Human QSOX1, N-HisAmino Acid Sequence : Molecular…
Product Name : Transient receptor potential cation channel subfamily V member 1Brief Description : Recombinant ProteinAccession No. : Uniprot ID:O35433Calculated MW : Target Sequence : Storage : Store at -20˚C.…
Name : Recombinant Oryza glumipatula Dof-type domain-containing protein protein ,N-GST TagBackground : Background : Biological Activity : Species : Oryza glumipatulaExpression System : Protein Accession : A0A0D9ZSH7Synonyms : Recombinant Oryza…
Product Name : Toll-like receptor 6Brief Description : Recombinant ProteinAccession No. : Uniprot ID:Q704V6Calculated MW : Target Sequence : Storage : Store at -20˚C. (Avoid repeated freezing and thawing.)Application Details…
Name : Recombinant Salmonella phage LPST10 LPST10_00010 protein , N-His tagBackground : Background : Biological Activity : Species : Salmonella phage LPST10Expression System : Protein Accession : A0A1W6DYA8Synonyms : Recombinant…
Product Name : Trefoil factor 3Brief Description : Recombinant ProteinAccession No. : Uniprot ID:Q07654Calculated MW : Target Sequence : Storage : Store at -20˚C. (Avoid repeated freezing and thawing.)Application Details…
Name : Recombinant Goatgrass Uncharacterized protein protein,C-His TagBackground : Background : Biological Activity : Species : Aegilops tauschii subsp. strangulata (Goatgrass)Expression System : Protein Accession : A0A453GQ74Synonyms : Recombinant Goatgrass…
Product Name : Metalloproteinase inhibitor 4Brief Description : Recombinant ProteinAccession No. : Uniprot ID:Q9JHB3Calculated MW : Target Sequence : Storage : Store at -20˚C. (Avoid repeated freezing and thawing.)Application Details…
Name : Recombinant Bursaphelenchus xylophilus Uncharacterized protein protein,N-His TagBackground : Background : Biological Activity : Species : Bursaphelenchus xylophilusExpression System : Protein Accession : A0A1I7RKI6Synonyms : Recombinant Bursaphelenchus xylophilus Uncharacterized…
Product Name : Signal transducer and activator of transcription 3Brief Description : Recombinant ProteinAccession No. : Uniprot ID:P61635Calculated MW : Target Sequence : Storage : Store at -20˚C. (Avoid repeated…
Name : Recombinant Bactrocera dorsalis CHS1 protein,C-His TagBackground : Background : Biological Activity : Species : Bactrocera dorsalisExpression System : Protein Accession : L0L3M2Synonyms : Recombinant Bactrocera dorsalis CHS1 protein,C-His…
Product Name : Syndecan-1Brief Description : Recombinant ProteinAccession No. : Uniprot ID:Q08DZ5Calculated MW : Target Sequence : Storage : Store at -20˚C. (Avoid repeated freezing and thawing.)Application Details : Storage…
Name : Recombinant Human CD93 proteinBackground : Background : Biological Activity : Species : Homo sapiens (Human)Expression System : Protein Accession : Q9NPY3Synonyms : Recombinant Human CD93 proteinAmino Acid Sequence…
Product Name : Superoxide dismutase Brief Description : Recombinant ProteinAccession No. : Uniprot ID:P04178Calculated MW : Target Sequence : Storage : Store at -20˚C. (Avoid repeated freezing and thawing.)Application Details…
Name : Recombinant Human HSPA9 proteinBackground : Background : Biological Activity : Species : Homo sapiens (Human)Expression System : Protein Accession : P38646Synonyms : Recombinant Human HSPA9 proteinAmino Acid Sequence…
Product Name : SclerostinBrief Description : Recombinant ProteinAccession No. : Uniprot ID:Q99P68Calculated MW : Target Sequence : Storage : Store at -20˚C. (Avoid repeated freezing and thawing.)Application Details : Storage…
Name : Recombinant Human CLU proteinBackground : Background : Biological Activity : Species : Homo sapiens (Human)Expression System : Protein Accession : P10909Synonyms : Recombinant Human CLU proteinAmino Acid Sequence…
Product Name : Signal recognition particle 54 kDa proteinBrief Description : Recombinant ProteinAccession No. : Uniprot ID:P61011Calculated MW : Target Sequence : Storage : Store at -20˚C. (Avoid repeated freezing…
Product Name : 40S ribosomal protein S14Brief Description : Recombinant ProteinAccession No. : Uniprot ID:Q29303Calculated MW : Target Sequence : Storage : Store at -20˚C. (Avoid repeated freezing and thawing.)Application…
Product Name : Secretin receptorBrief Description : Recombinant ProteinAccession No. : Uniprot ID:P23811Calculated MW : Target Sequence : Storage : Store at -20˚C. (Avoid repeated freezing and thawing.)Application Details :…
Product Name : Protein S100-BBrief Description : Recombinant ProteinAccession No. : Uniprot ID:P50114Calculated MW : Target Sequence : Storage : Store at -20˚C. (Avoid repeated freezing and thawing.)Application Details :…
Product Name : Peroxisome proliferator-activated receptor gamma coactivator-related protein 1Brief Description : Recombinant ProteinAccession No. : Uniprot ID:Q6NZN1Calculated MW : Target Sequence : Storage : Store at -20˚C. (Avoid repeated…
Product Name : Peptidyl-prolyl cis-trans isomerase BBrief Description : Recombinant ProteinAccession No. : Uniprot ID:P80311Calculated MW : Target Sequence : Storage : Store at -20˚C. (Avoid repeated freezing and thawing.)Application…
Product Name : Pyridoxal phosphate phosphataseBrief Description : Recombinant ProteinAccession No. : Uniprot ID:Q3ZBF9Calculated MW : Target Sequence : Storage : Store at -20˚C. (Avoid repeated freezing and thawing.)Application Details…
Product Name : Calcium/calmodulin-dependent 3′,5′-cyclic nucleotide phosphodiesterase 1CBrief Description : Recombinant ProteinAccession No. : Uniprot ID:Q64338Calculated MW : Target Sequence : Storage : Store at -20˚C. (Avoid repeated freezing and…
Product Name : Platelet-derived growth factor receptor alphaBrief Description : Recombinant ProteinAccession No. : Uniprot ID:Q9PUF6Calculated MW : Target Sequence : Storage : Store at -20˚C. (Avoid repeated freezing and…
Product Name : Neuropeptide SBrief Description : Recombinant ProteinAccession No. : Uniprot ID:P0C0P5Calculated MW : Target Sequence : Storage : Store at -20˚C. (Avoid repeated freezing and thawing.)Application Details :…
Product Name : Pro-neuropeptide YBrief Description : Recombinant ProteinAccession No. : Uniprot ID:P07808Calculated MW : Target Sequence : Storage : Store at -20˚C. (Avoid repeated freezing and thawing.)Application Details :…
Product Name : Recombinant Human α-Synuclein,SNCABrief Description : Accession No. : P37840Calculated MW : 14.7kDaTarget Sequence : GSHMDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEAStorage : Lyophilized protein should be stored at Reconstituted protein solution can be…
Product Name : Recombinant Human C-X-C Motif Chemokine 12,CXCL12,SDF-1 (22-93)Brief Description : Accession No. : P48061Calculated MW : 8.53kDaTarget Sequence : KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKMStorage : Lyophilized protein should be stored at Reconstituted…
Product Name : Beta-nerve growth factorBrief Description : Recombinant ProteinAccession No. : Uniprot ID:Q29074Calculated MW : Target Sequence : Storage : Store at -20˚C. (Avoid repeated freezing and thawing.)Application Details…
Product Name : Recombinant Human Growth Hormone-Releasing Factor,GHRF,Somatoliberin (C-Fc)Brief Description : Accession No. : P01286Calculated MW : 33.4kDaTarget Sequence : PPPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARLVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKStorage : Lyophilized protein should be stored at Reconstituted protein…
Product Name : Maternal embryonic leucine zipper kinaseBrief Description : Recombinant ProteinAccession No. : Uniprot ID:Q14680Calculated MW : Target Sequence : Storage : Store at -20˚C. (Avoid repeated freezing and…
Product Name : Recombinant Human WDFY3Brief Description : Recombinant ProteinAccession No. : Swissprot:Q8IZQ1Gene Accession:BC015214Calculated MW : Target Sequence : Storage : -20~-80˚C, pH 7.6 PBSApplication Details : Uniprot : Q8IZQ1MedChemExpress…
Product Name : Kallikrein-10Brief Description : Recombinant ProteinAccession No. : Uniprot ID:O43240Calculated MW : Target Sequence : Storage : Store at -20˚C. (Avoid repeated freezing and thawing.)Application Details : Storage…
Product Name : Recombinant Human ZNF43Brief Description : Recombinant ProteinAccession No. : Swissprot:P17038Gene Accession:BC006528Calculated MW : Target Sequence : Storage : -20~-80˚C, pH 7.6 PBSApplication Details : Uniprot : P17038MedChemExpress…
Product Name : Microtubule-associated proteins 1A/1B light chain 3BBrief Description : Recombinant ProteinAccession No. : Uniprot ID:O41515Calculated MW : Target Sequence : Storage : Store at -20˚C. (Avoid repeated freezing…
Name : Ebola virus EBOV (subtype Sudan, strain Gulu) GP1 / Glycoprotein Protein (His Tag) Biological Activity : Background : The fourth gene of the EBOV genome encodes a 16-kDa…
Name : Recombinant Rat Lymphotoxin-beta receptor/TNFRSF3 Protein (His Tag) Biological Activity : Background : LTBR (lymphotoxin beta receptor (TNFR superfamily, member 3)) is a member of the tumor necrosis factor…
Name : Recombinant Rat EphA3 Protein (His Tag) Biological Activity : Background : EphA3 gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors…
Name : Recombinant Mouse Tripeptidyl-peptidase 1/TPP1 Protein (His Tag) Biological Activity : Background : Tripeptidyl-peptidase 1 (TPP1 / CLN2) is a member of the sedolisin family of serine proteases. The…
Name : Recombinant Mouse SPARC Protein (His Tag), HPLC-verified Biological Activity : Background : Secreted protein acidic and rich in cysteine (SPARC), also known as Osteonectin (ON), is a member…
Name : Recombinant Mouse Neuropilin-1/NRP1 Protein (ECD, His Tag), HPLC-verified Biological Activity : Background : Neuropilin is a type I transmembrane protein and the molecular mass is 120 kDa. Two…
Name : Recombinant Mouse IL-12 p40/IL12B Protein (His Tag) Biological Activity : Background : Subunit beta of interleukin 12 (also known as natural killer cell stimulatory factor 2, or cytotoxic…
Name : Recombinant Mouse Follistatin Protein (His Tag) Biological Activity : Background : Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. The single FST gene encodes…
Name : Recombinant Mouse EphA3 Protein (aa 569-984) Biological Activity : Background : EphA3 gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors…
Name : Recombinant Mouse CD7 Protein (ECD, hFc Tag) Biological Activity : Background : The cluster of differentiation (CD) system is commonly used as cell markers in Immunophenotyping. Different kinds…
Name : Recombinant Mouse B7-H4 Protein (hFc Tag) Biological Activity : Background : V-set domain-containing T-cell activation inhibitor 1, also known as B7X, B7H4, B7S1, and VTCN1, is a single-pass…
Name : Influenza B (B/Utah/02/2012) Hemagglutinin / HA Protein (His Tag) Biological Activity : Background : The influenza viral Hemagglutinin (HA) protein is a homotrimer with a receptor binding pocket…
Name : TSLP ProteinDescription : Thymic stromal lymphopoietin (TSLP) is an interleukin 7 (IL-7)-like cytokine originally characterized by its ability to promote the activation of B cells and dendritic cells…
Name : TOP1 ProteinDescription : Species : HumanUniprotkb : Baculovirus-Insect CellsTag : HisSynonyms : Construction : A DNA sequence encoding the human TOP1 (NP_003277.1) (Met1-Phe765) was expressed with a polyhistidine…
Name : Ara h 9 ProteinDescription : Species : Arachis hypogaeaUniprotkb : P. pastorisTag : Tag FreeSynonyms : Construction : Protein Purity : ≥ 90 % as determined by SDS-PAGE.Molecular…
Name : ST2/IL-1 RL1 ProteinDescription : ST2, also called IL-1 R4, is an Interleukin-1 receptor family glycoprotein that plays a role in Th2 immune responses. ST2 is expressed on the…
Name : Siglec-6 ProteinDescription : Siglecs (Sialic acid binding Ig-like Lectins) are I-type (Ig-type) lectins that belong to the Ig superfamily. They are characterized by an N-terminal Ig-like V-type domain…
Product Name : Canine Coagulation Factor III ProteinEN Description: | Canine Coagulation Factor III/Tissue Factor Protein with the C-His Tag |Source: The reco|>95% by SEC-HPLC and SDS-|Less than 1 EU…
Name : APOA1BP ProteinDescription : APOA1BP, now renamed NAXE, encodes an epimerase essential in the cellular metabolite repair for NADHX and NADPHX. The enzyme catalyzes the epimerization of NAD(P)HX, thereby…
Product Name : Biotinylated Human TRAIL R4 ProteinEN CD264; RSF10D; TRAILR4; DCR2; TRUNDD; TNFRSF10DDescription: | Biotinylated Human TRAIL R4/TNFRSF10D Protein with the C-His-Avi Tag |Source: The reco|>95% by SEC-HPLC and…
Product Name : Biotinylated Human Integrin alpha V beta 8 (ITGAV&ITGB8) Heterodimer ProteinEN Description: | Biotinylated Human Integrin alpha V beta 8 (ITGAV&ITGB8) Heterodimer Protein with the C-His-Avi Tag |Source:…
Name : SARS-CoV-2 Spike RBD Protein (S477IDescription : The spike (S) glycoprotein of coronaviruses contains protrusions that will only bind to certain receptors on the host cell. Known receptors bind…
Product Name : Biotinylated Cynomolgus IL-2 R beta ProteinEN Description: | Biotinylated Cynomolgus IL-2 R beta/CD122 Protein with the C-His Tag |Source: The reco|>95% by SEC-HPLC and SDS-|Less than 1…
Name : SARS-CoV-2 NSP10 Protein (His)Description : NSP10 is a major regulator of coronavirus replicase function. NSP10 contains two zinc fingers and binds and stimulates both NSP14 and NSP16 activities.…
Product Name : Human HLA-A*02:01&B2M&AFP (FMNKFIYEI) Tetramer ProteinEN Alpha-fetoprotein; Alpha-1-fetoprotein; Alpha-feto; AFP; HPAFP; AFPD; FETA; MHCDescription: | Human HLA-A*02:01&B2M&AFP (FMNKFIYEI) Tetramer Protein with the C-His-Avi Tag |Source: The reco|>95% by…
Name : RBP5 ProteinDescription : Species : HumanUniprotkb : E. coliTag : HisSynonyms : CRBPIII, retinol binding protein 5, CRBP3, RBP5, CRBP-IIIConstruction : A DNA sequence encoding the human RBP5…
Product Name : Human Fc gamma RIIIA ProteinEN Description: | Human Fc gamma RIIIA/CD16a (V176) Domain 2 Protein with the C-mFc Tag |Source: The reco|>95% by SEC-HPLC and SDS-|Less than…
Name : PRMT3 ProteinDescription : Protein arginine methyltransferase 3, also known as PRMT3, is one of four type I protein arginine methyltransferases (PRMT) that in humans is encoded by the…
Product Name : Human CD27 Ligand ProteinEN CD70 molecule; CD70; TNFSF7; CD27 Ligand; CD27-L; CD27LG;-Ki-24 antigen; TNFSF7GDescription: | Human CD27 Ligand/CD70 Protein with the N-hFc Tag |Source: The reco|The reco|>95%…
Name : PLGF/PGF ProteinDescription : Species : HumanUniprotkb : E. coliTag : Tag FreeSynonyms : PLGF, PGFL, placental growth factor, D12S1900, SHGC-10760, PLGF-2Construction : A DNA sequence encoding the human…
Product Name : Human ANGPTL7 ProteinEN angiopoietin-like 7; Angiopoietin-like factor; ANGPTL7; AngX; CDT6; dJ647M16.1; RP4-647M16.2Description: | Human ANGPTL7/CDT6 Protein with the C-hFc Tag |Source: The reco|>95% by SEC-HPLC and SDS-|Less…
Name : PGA4 ProteinDescription : PGA4 (Pepsinogen 4, group I), or Pepsinogen A, is a member of the peptidase A1 family. Pepsin is expressed as a pro-form zymogen, pepsinogen, whose…
Product Name : HLA-A*02:01&B2M&MART-1 (ELAGIGILTV) Monomer ProteinEN Description: | HLA-A*02:01&B2M&MART-1 (ELAGIGILTV) Monomer Protein with the C-His-Avi Tag |Source: The reco|>95% by SEC-HPLC and SDS-|Less than 1 EU per ug of…
Name : PCSK1 ProteinDescription : Neuroendocrine convertase 1, also known as Prohormone convertase 1, Proprotein convertase 1, PCSK1 and NEC1, is an enzyme which belongs to the peptidase S8 family…
Product Name : GP2 ProteinEN Glycoprotein 2 (zymogen granule membrane), Pancreatic zymogen granule membrane protein GP-2, ZAP75Description: |Introduction Crohn’s Disease (CD), which is very common in Caucasians, is an inflammatory…
Product Name : GL EnzymeEN Gastric triacylglycerol lipase, Gastric lipase, EC 3.1.1.3, LIPFDescription: |Introduction Gastric triacylglycerol li|HEK 293-derived. Purity > 95%, by reducing SDS-|The product is shipped at a|Use a…
Name : MSLN/Mesothelin ProteinDescription : Mesothelin, also known as MSLN, is a protein that in humans is encoded by the MSLN gene.Cloning studies showed that the mesothelin gene encodes a…
Product Name : FLT1 D5 EnzymeEN Fms-like tyrosine kinase 1, Tyrosine-protein kinase receptor FLT, Flt-1, Tyrosine-protein kinase FRT, VEGFR-1Description: |Introduction Endothelial cells express three different vascular endothelial growth factor (VEGF)…
Product Name : FADD ProteinEN Fas-Associated Death Domain, Mediator of receptor induced toxicity, Growth-inhibiting gene 3 protein, GIG3, MORT1, MGC8528Description: |Introduction FADD is an adaptor protein that cooperates with a…
Name : Albumin ProteinDescription : Species : HumanUniprotkb : YeastTag : Tag FreeSynonyms : PRO0883, PRO1341, ANALBA, PRO0903, FDAH, albuminConstruction : A DNA sequence encoding human HSA (NP_000468.1)(Met1-Leu609, Ala215Val, natrual…
Name : LIF ProteinDescription : Leukemia inhibitory factor (LIF) is a pleiotropic glycoprotein belonging to the IL-6 family of cytokines. It is involved in growth promotion and cell differentiation of…
Name : KRTHB1 (Human) Recombinant Protein (P01) Biological Activity : Human KRTHB1 full-length ORF ( AAH21241, 1 a.a. – 202 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength…
Name : LDHA ProteinDescription : L-Lactate Dehydrogenase A Chain (LDHA) is an enzyme that catalyzes the conversion of L-lactate and NAD+ to pyruvate and NADH in the final step of…
Name : ITGB8 (Human) Recombinant Protein (Q01) Biological Activity : Human ITGB8 partial ORF ( NP_002205, 392 a.a. – 503 a.a.) recombinant protein with GST-tag at N-terminal. Tag : Best…
Name : Kallikrein 5/KLK5 ProteinDescription : Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many Kallikreins are implicated in carcinogenesis and some have…
Name : IL10RB (Human) Recombinant Protein Biological Activity : Human IL10RB full-length ORF (NP_000619.3) recombinant protein without tag.This product is belong to Proteoliposome (PL).Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength,Proteoliposome,Proteoliposomes,Membrane Protein,Membrane Proteins Tag…
Name : JAM-B ProteinDescription : Junctional adhesion molecule B (JAM-B), also known as Junctional adhesion molecule 2 (JAM2), Vascular endothelial junction-associated molecule (VE-JAM), and CD322, is a single-pass type I…
Name : HSD11B2 (Human) Recombinant Protein (Q01) Biological Activity : Human HSD11B2 partial ORF ( AAH64536.1, 71 a.a. – 170 a.a.) recombinant protein with GST-tag at N-terminal. Tag : Best…
Name : Influenza A H3N2 (A/Victoria/361/2011) Hemagglutinin Protein (His)Description : The influenza viral Hemagglutinin (HA) protein is a homotrimer with a receptor binding pocket on the globular head of each…
Name : HOXB1 (Human) Recombinant Protein (P01) Biological Activity : Human HOXB1 full-length ORF ( AAH96192.1, 1 a.a. – 235 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength…
Name : Influenza A H1N1 (A/swine/Denmark/12813-1/2004) Hemagglutinin/HA Protein (His)Description : The influenza viral Hemagglutinin (HA) protein is a homotrimer with a receptor binding pocket on the globular head of each…
Name : HK1 (Human) Recombinant Protein (Q01) Biological Activity : Human HK1 partial ORF ( NP_277031, 101 a.a. – 200 a.a.) recombinant protein with GST-tag at N-terminal. Tag : Best…
Name : Influenza A H10N8 (A/Jiangxi-Donghu/346/2013) Hemagglutinin/HA Protein (His)Description : The influenza viral Hemagglutinin (HA) protein is a homotrimer with a receptor binding pocket on the globular head of each…
Name : IL-3R alpha/CD123 ProteinDescription : CD123, also known as Interleukin-3 receptor subunit alpha, belongs to the type I cytokine receptor family. In mouse, there are two classes of high-affinity…
Name : GPER (Human) Recombinant Protein Biological Activity : Human GPER full-length ORF (NP_001496.1) recombinant protein without tag.This product is belong to Proteoliposome (PL).Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength,Proteoliposome,Proteoliposomes,Membrane Protein,Membrane Proteins Tag…
Name : IL-18BP ProteinDescription : Cytokines were the first modern immunotherapies to produce durable responses in patients with advanced cancer,components of the interleukin-18 (IL-18) pathway are upregulated on tumour-infiltrating lymphocytes,…
Name : GABRE (Human) Recombinant Protein (P01) Biological Activity : Human GABRE full-length ORF ( AAH59376, 1 a.a. – 365 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength…
Name : IGFBP-2 ProteinDescription : IGFBP-2, also known as IGFBP2, is an insulin-like growth factor-binding protein (IGFBP). IGFBPs prolong the half-life of the IGFs, control bioavailability, activity, and distribution of…
Name : CD7 (Human) Recombinant Protein Biological Activity : Human CD7 (P09564, 26 a.a. – 180 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli. Tag…
Name : IL-11 ProteinDescription : IL11 is a multifunctional cytokine first isolated in 199 from bone marrow-derived stromal cells. It is a key regulator of multiple events in hematopoiesis, most…
Name : CD276 (Human) Recombinant Protein Biological Activity : Human CD276 (Q5ZPR3, 29 a.a. – 466 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells. Tag…
Name : Cxcl12 (Mouse) Recombinant Protein Biological Activity : Mouse Cxcl12 (P40224, 22 a.a. – 89 a.a.) partial recombinant protein expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins Tag :…
Name : DHH (Human) Recombinant Protein Biological Activity : Human DHH partial recombinant protein with His tag in N-terminus expressed in Escherichia coli. Tag : Protein Accession No. : O43323…
Name : FXN (Human) Recombinant Protein (P01) Biological Activity : Human FXN full-length ORF ( AAH48097.1, 1 a.a. – 210 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength…
Name : CD40 (Human) Recombinant Protein Biological Activity : Human CD40 (P25942, 21 a.a. – 193 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in Escherichia coli. Tag…
Name : IFNA1 (Human) Recombinant Protein Biological Activity : Human IFNA1 recombinant protein expressed in?Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins Tag : Protein Accession No. : P01562 Protein Accession No.URL…
Name : IFI30 (Human) Recombinant Protein Biological Activity : Human IFI30 partial recombinant protein with His tag in N-terminus expressed in Escherichia coli. Tag : Protein Accession No. : P13284…
Name : FOXI1 (Human) Recombinant Protein (P01) Biological Activity : Human FOXI1 full-length ORF ( NP_658982.1, 1 a.a. – 283 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength…
Name : Il4 (Mouse) Recombinant Protein Biological Activity : Mouse Il4 (P07750, 21 a.a. – 140 a.a.) partial recombinant protein expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins Tag :…
Name : IL7 (Human) Recombinant Protein Biological Activity : Human IL7 (P13232, 26 a.a. – 177 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli. Tag…
Name : CD47 (Human) Recombinant Protein Biological Activity : Human CD47 (Q08722, 19 a.a. – 141 a.a.) partial length recombinant protein His tag expressed in Baculovirus expression system.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional…
Name : AKR1B1 (Human) Recombinant Protein (P01) Biological Activity : Human AKR1B1 full-length ORF ( AAH00260.1, 1 a.a. – 316 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength…
Name : CD40LG (Human) Recombinant Protein Biological Activity : Human CD40LG recombinant protein with polyhistidine tag at the C-terminus expressed in Escherichia coli. Tag : Result of activity analysis Protein…
Name : SNAPC1 (Human) Recombinant Protein Biological Activity : Human SNAPC1 (NP_003073, 1 a.a. – 368 a.a ) full-length recombinant protein with His tag expressed in Escherichia coli.Full-Length Protein,Full-Length Proteins,Full-Length,Full…
Name : FASN (Human) Recombinant Protein (Q01) Biological Activity : Human FASN partial ORF ( NP_004095, 2378 a.a. – 2477 a.a.) recombinant protein with GST-tag at N-terminal. Tag : Best…
Product Name : Cynomolgus IL-4 R alpha/CD124 Protein 3107express system : HEK293Product tag : C-HisPurity: > 95% as determined by Tris-Bis PAGE;> 95% as determined by HPLCBackground: Interleukin 4 Receptor…
Name : Neutrophil Elastase (Human) Native Protein Biological Activity : Human Neutrophil Elastase native protein from human neutrophil.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins Tag : This product contains sodium azide: a…
Product Name : Cynomolgus BAFFR/TNFRSF13C Protein 4400express system : HEK293Product tag : C-HisPurity: > 95% as determined by Tris-Bis PAGEBackground: BAFF binds to three TNF receptor superfamily members: B-cell maturation…
Name : Ifng (Mouse) Recombinant Protein Biological Activity : Mouse Ifng (P01580) recombinant protein expressed in E.Coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins Tag : Result of activity analysis Protein Accession No.…
Product Name : Biotinylated Human Syndecan-1 Protein 3678express system : HEK293Product tag : C-His-AviPurity: > 95% as determined by Tris-Bis PAGEBackground: Liver diseases such as liver cirrhosis, primary and metastatic…
Name : S1 (SARS-CoV) Recombinant Protein Biological Activity : SARS-CoV S1 (12 a.a.- 53 a.a.; 90 a.a.- 115 a.a.; 171 a.a.- 203 a.a.) partial recombinant protein expressed in Escherichia coli.…
Product Name : Biotinylated Human LILRB2/CD85d/ILT4 Protein 4781express system : HEK293Product tag : C-His-AviPurity: > 95% as determined by Tris-Bis PAGE;> 95% as determined by HPLCBackground: The immunoglobulin-like transcript (ILT)…
Name : PDGFRB (Human) Recombinant Protein Biological Activity : Human PDGFRB (NP_002600.1, 557 a.a. – 1106 a.a.) partial recombinant protein with GST-tag at N-terminal using baculovirus expression system.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional…
Product Name : Mouse PD-1/PDCD1 Protein 4249express system : HEK293Product tag : C-hFcPurity: > 95% as determined by Tris-Bis PAGE;> 95% as determined by HPLCBackground: Programmed cell death protein 1,…
Name : ACTN4 (Human) Recombinant Protein (Q02) Biological Activity : Human ACTN4 partial ORF (NP_004915.2, 612 a.a. – 911 a.a.) recombinant protein with GST tag at N-terminal. Tag : Best…
Name : ESRRA (Human) Recombinant Protein (P01) Biological Activity : Human ESRRA full-length ORF ( NP_004442.3, 1 a.a. – 423 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength…
Product Name : Mouse IL-31 RA Protein 3955express system : HEK293Product tag : C-HisPurity: > 95% as determined by Tris-Bis PAGE;> 95% as determined by HPLCBackground: Interleukin-31 receptor A (IL-31RA)…
Name : ACRV1 (Human) Recombinant Protein (P01) Biological Activity : Human ACRV1 full-length ORF ( AAH14588, 1 a.a. – 265 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength…
Name : EGFR (Human) Recombinant Protein Biological Activity : Human EGFR (NP_005219.2, 669 a.a. – 1210 a.a.) parial recombinant protein with GST tag expressed in Baculovirus infected Sf21 cells.Bioactive Protein,Bioactive…
Product Name : Mouse CD200/OX-2 Protein 3839express system : HEK293Product tag : C-HisPurity: > 95% as determined by Tris-Bis PAGE;> 95% as determined by HPLCBackground: CD200 and its receptors are…
Name : Human Siglec-3 / CD33 Protein, His Tag (MALS verified) Background : Myeloid cell surface antigen CD33 is also known as SIGLEC3, Siglecs (sialic acid binding Iglike lectins) and…
Name : Ovalbumin (Egg White) Biological Activity : Lyophilized. Tag : Protein Accession No. : P01012 Protein Accession No.URL : https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=396058 Amino Acid Sequence : Molecular Weight : 45 Storage…
Name : gp120 (HIV-1/Clade B) Recombinant Protein Biological Activity : gp120 (HIV-1/Clade B) (M68893, 30 a.a. – 500 a.a.) partial recombinant protein with His tag expressed in 293 cells.Recombinant Human…
Name : Human Her2 / ErbB2 (S310Y) Protein, His Tag (MALS verified) Background : Human Epidermal growth factor Receptor 2 (HER2) is also called ERBB2, HER-2,HER-2 /neu, NEU, NGL,TKR1 and…
Name : HA1 (H9N2) (A/Guinea fowl/Hong Kong/WF10/99) Recombinant Protein Biological Activity : HA1 (H9N2) (A/Guinea fowl/Hong Kong/WF10/99) (AAO46082, 20 a.a. – 339 a.a.) partial recombinant protein with His tag expressed…
Product Name : Human MOG/Myelin Oligodendrocyte Glycoprotein Protein 3463express system : HEK293Product tag : C-HisPurity: > 95% as determined by Tris-Bis PAGE;> 95% as determined by HPLCBackground: Myelin oligodendrocyte glycoprotein…
Name : Human BTN1A1 / Butyrophilin Protein, Fc Tag Background : Butyrophilin subfamily 1 member A1 (BTN1A1) is also known as BTN, which is a member of the immunoglobulin superfamily…
Product Name : Human IL-31 RA Protein 4008express system : HEK293Product tag : C-HisPurity: > 95% as determined by Tris-Bis PAGE;> 95% as determined by HPLCBackground: Interleukin-31 receptor A (IL-31RA)…
Name : Human BTLA (31-150) Protein, Mouse IgG2a Fc Tag (MALS verified) Background : B- and T-lymphocyte attenuator (BTLA) is also known as B- and T-lymphocyte-associated protein, CD antigen CD272.…
Name : CXCL12 (Beta) (Human) Recombinant Protein Biological Activity : Human CXCL12 (beta) (P48061-1) recombinant protein expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins Tag : Protein Accession No. :…
Product Name : Human IL-1 R9 Protein 2311express system : HEK293Product tag : C-hFcPurity: > 95% as determined by Tris-Bis PAGE;> 95% as determined by HPLCBackground: The interleukin 1 receptor…
Name : Canine TIGIT Protein, His Tag (MALS verified) Background : T-cell immunoreceptor with Ig and ITIM domains (TIGIT) is also known as V-set and immunoglobulin domain-containing protein 9 (VSIG9),…
Name : Il2 (Mouse) Recombinant Protein Biological Activity : Mouse Il2 (P04351, 22 a.a. – 169 a.a.) partial recombinant protein expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins Tag :…
Name : Rhesus macaque PCSK9 Protein, His Tag Background : Proprotein convertase subtilisin/kexin type 9 (PCSK9) is also known as NARC1 (neural apoptosis regulated convertase), is a newly identified subtilase…
Name : VAMP5 (Human) Recombinant Protein Biological Activity : Human VAMP5 (NP_006625, 1 a.a. – 72 a.a.) partial recombinant protein with His tag expressed in Escherichia coli. Tag : Protein…
Name : PPIF (Human) Recombinant Protein Biological Activity : Human PPIF (NP_005720, 30 a.a. – 207 a.a.) partial recombinant protein expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins Tag :…
Name : DDI1 (Human) Recombinant Protein (P01) Biological Activity : Human DDI1 full-length ORF ( NP_001001711.1, 1 a.a. – 396 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength…
Name : OR56B1 (Human) Recombinant Protein Biological Activity : Human OR56B1 full-length ORF (Q8NGI3) recombinant protein without tag.This product is belong to Proteoliposome (PL).Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength,Proteoliposome,Proteoliposomes,Membrane Protein,Membrane Proteins Tag…
Name : THEMIS (Human) Recombinant Protein (P01) Biological Activity : Human THEMIS full-length ORF (ADR83235.1, 1 a.a. – 641 a.a.) recombinant protein with GST tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength…
Name : ECGF1 (Human) Recombinant Protein (P01) Biological Activity : Human ECGF1 full-length ORF ( AAH52211.1, 1 a.a. – 482 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength…
Name : RASGEF1C (Human) Recombinant Protein (P01) Biological Activity : Human RASGEF1C full-length ORF ( NP_778232.2, 1 a.a. – 466 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength…
Name : GPR97 (Human) Recombinant Protein Biological Activity : Human GPR97 full-length ORF (NP_740746.3) recombinant protein without tag.This product is belong to Proteoliposome (PL).Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength,Proteoliposome,Proteoliposomes,Membrane Protein,Membrane Proteins Tag…
Name : TIGD1 (Human) Recombinant Protein (P01) Biological Activity : Human TIGD1 full-length ORF (BAB71153.1, 1 a.a. – 591 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength Tag…
Name : MGC42105 (Human) Recombinant Protein (Q01) Biological Activity : Human MGC42105 partial ORF ( NP_699192, 342 a.a. – 435 a.a.) recombinant protein with GST-tag at N-terminal. Tag : Best…
Name : C22orf15 (Human) Recombinant Protein (P01) Biological Activity : Human C22orf15 full-length ORF ( NP_872326.1, 1 a.a. – 132 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength…
Name : ERICH1 (Human) Recombinant Protein (P01) Biological Activity : Human ERICH1 full-length ORF ( NP_997215.1, 1 a.a. – 443 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength…
Name : OR6B3 (Human) Recombinant Protein Biological Activity : Human OR6B3 full-length ORF (NP_775486.1) recombinant protein without tag.This product is belong to Proteoliposome (PL).Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength,Proteoliposome,Proteoliposomes,Membrane Protein,Membrane Proteins Tag…
Name : RNF36 (Human) Recombinant Protein (Q01) Biological Activity : Human RNF36 partial ORF ( NP_542783, 33 a.a. – 121 a.a.) recombinant protein with GST-tag at N-terminal. Tag : Best…
Name : RAET1E (Human) Recombinant Protein (P01) Biological Activity : Human RAET1E full-length ORF ( AAI03695.1, 1 a.a. – 263 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength…
Name : ACVR1C (Human) Recombinant Protein (P01) Biological Activity : Human ACVR1C full-length ORF ( AAH22530.1, 1 a.a. – 493 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength…
Name : C18orf37 (Human) Recombinant Protein (P01) Biological Activity : Human C18orf37 full-length ORF ( AAH48989, 1 a.a. – 137 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength…
Product Name : Anti-Human ALK1/ACVRL1 Antibody BiosimilarHost species : HumanSpecies reactivity : HumanForm: LiquidStorage buffer : 0.01M PBS, pH 7.4.Concentration: 1 mg/mlPurity : >95% by SDS-PAGE.Clonality: MonoclonalApplications : Research Grade…
Name : AKR1C1 (Human) Recombinant Protein (P01) Biological Activity : Human AKR1C1 full-length ORF ( NP_001344.2, 1 a.a. – 323 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength…
Product Name : Recombinant Human DKK2 ProteinTargetID : Q9UBU2Source : E.coliGene Accession Number : 27123Peptide Sequence : 34-259aaTag : N-6HisPurity : >85% as determined by SDS-PAGE.Formulation : Freeze-dried powderStorage Buffer…
Product Name : Anti-Human CD123/IL3RA Antibody BiosimilarHost species : HumanizedSpecies reactivity : HumanForm: LiquidStorage buffer : 0.01M PBS, pH 7.4.Concentration: 1 mg/mlPurity : >95% by SDS-PAGE.Clonality: Applications : Research Grade…
Name : CCDC5 (Human) Recombinant Protein (Q01) Biological Activity : Human CCDC5 partial ORF ( NP_612452.1, 179 a.a. – 278 a.a.) recombinant protein with GST-tag at N-terminal. Tag : Best…
Product Name : Recombinant Human EGF Like Domain Protein, Multiple 6 (EGFL6)TargetID : Q8IUX8Source : E.coliGene Accession Number : 25975Peptide Sequence : Gly30-Asp219Tag : N-6HisPurity : > 90%Formulation : Freeze-dried…
Name : TMEM200A (Human) Recombinant Protein (P01) Biological Activity : Human TMEM200A full-length ORF ( NP_443145.1, 1 a.a. – 491 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength…
Product Name : Recombinant Human Collagen Type III Alpha 1 (COL3a1)TargetID : P02461Source : E.coliGene Accession Number : 1281Peptide Sequence : Gly1059-Leu1466Tag : N-terminal His and GST TagPurity : >…
Product Name : VWF Monoclonal Antibody (OTI1D3), TrueMAB™Species Reactivity: HumanHost/Isotype : Mouse / IgG2bClass:MonoclonalType : AntibodyClone: OTI1D3Conjugate : UnconjugatedForm: lyophilizedConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH 7.3,…
Product Name : Recombinant Interleukin 18 Receptor 1 (IL18R1)TargetID : A0A8I6A1C2Source : E.coliGene Accession Number : Peptide Sequence : Ala18~His321Tag : N-6HisPurity : > 90%Formulation : Freeze-dried powderStorage Buffer :…
Product Name : VSNL1 Monoclonal Antibody (OTI3G6), TrueMAB™Species Reactivity: HumanHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: OTI3G6Conjugate : UnconjugatedForm: lyophilizedConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH 7.3,…
Name : CG018 (Human) Recombinant Protein (P01) Biological Activity : Human CG018 full-length ORF ( NP_001073159.1, 1 a.a. – 173 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength…
Product Name : Recombinant Human TRAIL R1 / CD261 / TNFRSF10A Protein (Fc tag)TargetID : O00220Source : HEK293 CellsGene Accession Number : 8797Peptide Sequence : Met 1-Asn 239Tag : C-FcPurity…
Product Name : VISTA Monoclonal Antibody (B7H5DS8), PE-Cyanine7, eBioscience™Species Reactivity: HumanHost/Isotype : Mouse / IgG1, kappaClass:MonoclonalType : AntibodyClone: B7H5DS8Conjugate : PE-Cyanine7 View additional formats APC FITC PE PE-eFluor 610Form: LiquidConcentration…
Product Name : VKORC1L1 Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 2 mg/mLPurification : Protein A, Antigen affinity chromatographyStorage buffer:…
Name : KRTAP4-4 (Human) Recombinant Protein (P01) Biological Activity : Human KRTAP4-4 full-length ORF ( NP_115913.1, 1 a.a. – 166 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength…
Product Name : Recombinant Human EphB2 Protein (aa 570-987, His &GST Tag)TargetID : P29323Source : Baculovirus-Insect CellsGene Accession Number : 2048Peptide Sequence : Gly570-Val987Tag : N-His-GSTPurity : >90% as determined…
Product Name : VIM Polyclonal Antibody, MaxPab™Species Reactivity: HumanHost/Isotype : Mouse / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer: PBS, pH 7.4Contains : no…
Name : PCGF5 (Human) Recombinant Protein (P01) Biological Activity : Human PCGF5 full-length ORF ( NP_115749.2, 1 a.a. – 256 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength…
Name : PCBD2 (Human) Recombinant Protein (P01) Biological Activity : Human PCBD2 full-length ORF ( NP_115527.2, 1 a.a. – 129 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength…
Product Name : VASP Monoclonal Antibody (OTI1F3), TrueMAB™Species Reactivity: Dog, HumanHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: OTI1F3Conjugate : UnconjugatedForm: liquidConcentration : 0.55 mg/mLPurification : Affinity chromatographyStorage buffer: PBS with…
Name : TAS1R1 (Human) Recombinant Protein (Q01) Biological Activity : Human TAS1R1 partial ORF ( NP_619642, 281 a.a. – 380 a.a.) recombinant protein with GST-tag at N-terminal. Tag : Best…
Product Name : Recombinant Rat CD55 / DAF Protein (Fc tag)TargetID : A0A8I5XWT0Source : HEK293 CellsGene Accession Number : Peptide Sequence : Met1-Ser371Tag : C-FcPurity : >85% as determined by…
Product Name : rabbit anti-beta actin monoclonal antibody 9038Host : rabbitIsotype : IgGClonality: monoclonalConcentration: 1 mg/mLApplications: ELISA, ICC/IF, WBRractivity : Available sizes: 100 µgAdditiona Information: 9 5 2 inhostrabbit|isotypeIgG|clonalitymonoclonal|concentration1 mg/mL|applicationsELISA,…
Name : REC14 (Human) Recombinant Protein (P01) Biological Activity : Human REC14 full-length ORF ( AAH10080, 1 a.a. – 305 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength…
Product Name : Recombinant Human MSR1 / SCARA1 / CD204 Protein (His tag)TargetID : P21757Source : HEK293 CellsGene Accession Number : 4481Peptide Sequence : Lys 77-Leu 451Tag : N-HisPurity :…
Product Name : Urelumab Recombinant Human Monoclonal AntibodySpecies Reactivity: HumanHost/Isotype : Human / IgG4, kappaClass:Recombinant MonoclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1.29 mg/mLPurification : Protein AStorage buffer: 30mM…
Product Name : Recombinant Mouse CD19 / Leu-12 Protein (His tag)TargetID : P25918Source : HEK293 CellsGene Accession Number : 12478Peptide Sequence : Met1-Gly287Tag : C-HisPurity : >95% as determined by…
Product Name : USP53 Polyclonal Antibody, MaxPab™Species Reactivity: HumanHost/Isotype : Mouse / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer: PBS, pH 7.4Contains : no…
Product Name : Recombinant Human CD97 Protein (Fc tag)TargetID : P48960Source : HEK293 CellsGene Accession Number : 976Peptide Sequence : Met 1-Gln 398Tag : C-FcPurity : >95% as determined by…
Product Name : USP13 Monoclonal Antibody (OTI4G1), TrueMAB™Species Reactivity: HumanHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: OTI4G1Conjugate : UnconjugatedForm: liquidConcentration : 0.9 mg/mLPurification : Affinity chromatographyStorage buffer: PBS with 1%…
Product Name : Recombinant Human Mesothelin/MSLN/CAK1/MPF Protein(C-Fc)TargetID : Q13421Source : HEK293 CellsGene Accession Number : 10232Peptide Sequence : Leu37-Arg286Tag : C-FcPurity : >90% as determined by SDS-PAGE.Formulation : Freeze-dried powderStorage…
Product Name : UNG Monoclonal Antibody (OTI1G2)Species Reactivity: Human, Non-human primateHost/Isotype : Mouse / IgG2bClass:MonoclonalType : AntibodyClone: OTI1G2Conjugate : UnconjugatedForm: LiquidConcentration : 0.3 mg/mLPurification : Affinity ChromatographyStorage buffer: PBS, pH…
Product Name : Recombinant Human CD47 ProteinTargetID : Q08722Source : HEK293 CellsGene Accession Number : 961Peptide Sequence : Met 1-Pro 139Tag : Purity : >85% as determined by SDS-PAGE.Formulation :…
Product Name : UCHL3 Recombinant Rabbit Monoclonal Antibody (ARC1874)Species Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: ARC1874Conjugate : UnconjugatedForm: LiquidConcentration : 0.5 mg/mLPurification : Affinity chromatographyStorage…
Product Name : Eukaryotic Calreticulin (CALR)TargetID : P27797Source : HEK293 CellsGene Accession Number : 811Peptide Sequence : Glu18~Leu417Tag : N-6HisPurity : >95% as determined by SDS-PAGE.Formulation : Freeze-dried powderStorage Buffer…
Product Name : UCHL5IP Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.43 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH 7.3, with…
Product Name : UBE2N Monoclonal Antibody (4C11-G11)Species Reactivity: HumanHost/Isotype : Mouse / IgG1, kappaClass:MonoclonalType : AntibodyClone: 4C11-G11Conjugate : UnconjugatedForm: LiquidConcentration : See LabelPurification : Affinity chromatographyStorage buffer: PBS, pH 7.4Contains…
Product Name : Recombinant Human NRAS Protein (His tag)TargetID : P24530Source : E.coliGene Accession Number : 1910Peptide Sequence : Met 1-Cys186Tag : N-HisPurity : >95% as determined by SDS-PAGE.Formulation :…
Product Name : U2AF1L4 Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.5 mg/mLPurification : Affinity chromatographyStorage buffer: PBS with 2% sucroseContains :…
Product Name : Recombinant Human S100A2 Protein (Fc tag)TargetID : P29034Source : HEK293 CellsGene Accession Number : 6273Peptide Sequence : Met 2-Pro98Tag : N-FcPurity : >95% as determined by SDS-PAGE.Formulation…
Product Name : Recombinant Mouse NEGR1 Protein (His tag)TargetID : Q80Z24Source : HEK293 CellsGene Accession Number : 320840Peptide Sequence : Met 1-Gly 318Tag : C-HisPurity : >85% as determined by…
Product Name : Recombinant Mouse Pleiotrophin / PTN / HB-GAM ProteinTargetID : P63089Source : Baculovirus-Insect CellsGene Accession Number : 19242Peptide Sequence : Met1-Asp168Tag : Purity : >90% as determined by…
Product Name : Thymidine Phosphorylase Monoclonal Antibody (P-GF.44C)Species Reactivity: HumanHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: P-GF.44CConjugate : UnconjugatedForm: LiquidConcentration : 1.0 mg/mLPurification : Protein AStorage buffer: PBSContains : 0.02%…
Product Name : Recombinant Mouse Legumain/Asparaginyl Endopeptidase ProteinTargetID : O89017Source : HEK293 CellsGene Accession Number : 19141Peptide Sequence : Val 18-Tyr 435Tag : C-6HisPurity : >90% as determined by SDS-PAGE.Formulation…
Product Name : Recombinant Human Kallikrein 11 ProteinTargetID : Q9UBX7Source : HEK293 CellsGene Accession Number : 11012Peptide Sequence : Glu19-Asn250Tag : C-6HisPurity : >85% as determined by SDS-PAGE.Formulation : Freeze-dried…
Product Name : Recombinant Human Activator of Hsp90 ATPase-1 /AHA1 ProteinTargetID : O95433Source : E.coliGene Accession Number : 10598Peptide Sequence : 19-337Tag : Purity : >85% as determined by SDS-PAGE.Formulation…
Product Name : TTC21B Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Antigen affinity chromatographyStorage buffer: PBS with 50% glycerolContains :…
Product Name : Recombinant Mouse TSLP Protein (His tag)TargetID : Q9JIE6Source : HEK293 CellsGene Accession Number : 53603Peptide Sequence : Met 1-Glu 140Tag : C-HisPurity : >85% as determined by…
Product Name : Recombinant Human GABA ProteinTargetID : O95166Source : E.coliGene Accession Number : 11337Peptide Sequence : Met 1-Gln116Tag : N-6His,C-FcPurity : >90% as determined by SDS-PAGE.Formulation : Freeze-dried powderStorage…
Name : ORAI2 (Human) Recombinant Protein (P01) Biological Activity : Human ORAI2 full-length ORF ( NP_116220.1, 1 a.a. – 254 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength…
Product Name : TRK fused gene Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.17 mg/mLPurification : Antigen affinity chromatographyStorage buffer:…
Name : ALS2CR8 (Human) Recombinant Protein (P01) Biological Activity : Human ALS2CR8 full-length ORF ( NP_079020.12, 1 a.a. – 718 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength…
Product Name : TRIM5 gamma Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBSContains : 0.02%…
Name : LRRC2 (Human) Recombinant Protein (P01) Biological Activity : Human LRRC2 full-length ORF ( NP_079026.2, 1 a.a. – 371 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength…
Product Name : TRF2 Monoclonal Antibody (3H6B4)Species Reactivity: HumanHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: 3H6B4Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein GStorage buffer: PBSContains : 0.05% sodium…
Name : ZNF343 (Human) Recombinant Protein (P02) Biological Activity : Human ZNF343 full-length ORF ( ENSP00000370652, 1 a.a. – 118 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength…
Name : C20orf81 (Human) Recombinant Protein (P01) Biological Activity : Human C20orf81 full-length ORF ( AAH37240, 1 a.a. – 454 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength…
Product Name : TRAF1 (TNFR-Associated Factor 1) (Lymphomatoid Papulosis Marker) Monoclonal Antibody (TRAF1/3299)Species Reactivity: HumanHost/Isotype : Mouse / IgG1, kappaClass:MonoclonalType : AntibodyClone: TRAF1/3299Conjugate : UnconjugatedForm: LiquidConcentration : 200 µg/mLPurification :…
Name : SIL1 (Human) Recombinant Protein (P01) Biological Activity : Human SIL1 full-length ORF ( NP_071909.1, 1 a.a. – 461 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength…
Product Name : TOP2A Monoclonal Antibody (OTI1E11), TrueMAB™Species Reactivity: HumanHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: OTI1E11Conjugate : UnconjugatedForm: lyophilizedConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH 7.3,…
Name : CHP2 (Human) Recombinant Protein (P01) Biological Activity : Human CHP2 full-length ORF (BAG35891.1, 1 a.a. – 196 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength Tag…
Name : ANKRA2 (Human) Recombinant Protein (P01) Biological Activity : Human ANKRA2 full-length ORF ( NP_075526.1, 1 a.a. – 313 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength…
Ifficult to prepare and we currently only offer ddC. An alternative approach to the preparation of these oligos is to synthesize in the 5′-3′ direction, using 5’supports and phosphoramidites, with…
Product Name : TNFS15/VEGI (Vascular Endothelial Growth Inhibitor) Recombinant Rabbit Monoclonal Antibody (VEGI/7799R)Species Reactivity: HumanHost/Isotype : Rabbit / IgG, kappaClass:Recombinant MonoclonalType : AntibodyClone: VEGI/7799RConjugate : UnconjugatedForm: LiquidConcentration : 200 µg/mLPurification…
Name : VPS18 (Human) Recombinant Protein (Q01) Biological Activity : Human VPS18 partial ORF ( NP_065908, 3 a.a. – 100 a.a.) recombinant protein with GST-tag at N-terminal. Tag : Best…
482nm is 78,300 L/mol.cm. Our experimental work has shown that these products are fully compatible with regular oligonucleotide synthesis and deprotection. A coupling time of 12 minutes is recommended for…
Product Name : TNFR1 Monoclonal Antibody (47803)Species Reactivity: Mouse, RatHost/Isotype : Rat / IgG1Class:MonoclonalType : AntibodyClone: 47803Conjugate : UnconjugatedForm: LyophilizedConcentration : 0.5 mg/mLPurification : Protein A/GStorage buffer: PBS with 5%…
Name : TWSG1 (Human) Recombinant Protein (Q01) Biological Activity : Human TWSG1 partial ORF ( NP_065699, 124 a.a. – 223 a.a.) recombinant protein with GST-tag at N-terminal. Tag : Best…
Inc. to recommence the supply of these two valuable products. We believe these will be a welcome addition to the selection of modified bases that affect hybridization. References: C-5 propynyl…
Product Name : TMEM163 Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.5 mg/mLPurification : Affinity ChromatographyStorage buffer: PBS, pH 7.4, with 2%…
Product Name : TMEM68 Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.2 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH 7.2, with…
Product Name : TMEM232 Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.1 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH 7.2, with…
Product Name : TLE1 Monoclonal Antibody (OTI1D6), TrueMAB™Species Reactivity: HumanHost/Isotype : Mouse / IgG2aClass:MonoclonalType : AntibodyClone: OTI1D6Conjugate : Unconjugated View additional formats BiotinForm: lyophilizedConcentration : 1 mg/mLPurification : Affinity chromatographyStorage…
Product Name : TIPARP Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.5 mg/mLPurification : Affinity ChromatographyStorage buffer: PBS with 2% sucroseContains :…
Product Name : TIGIT Monoclonal Antibody (MBSA43), Alexa Fluor™ 647, eBioscience™Species Reactivity: HumanHost/Isotype : Mouse / IgG1, kappaClass:MonoclonalType : AntibodyClone: MBSA43Conjugate : Alexa Fluor™ 647 View additional formats Alexa Fluor…
Product Name : TIA1 Polyclonal Antibody, BiotinSpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : BiotinForm: LiquidConcentration : 0.5-1.5 mg/mLPurification : Affinity chromatographyStorage buffer: proprietary buffer,…
Product Name : integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41)Target gene : ITGA2Bverified_species_reactivity : Humaninterspecies_information : 81%, ENSMUSG00000034664, species_id: MOUSE, 77%, ENSRNOG00000022071, species_id: RATclonality : Polyclonalisotype…
Product Name : TGM2 Monoclonal Antibody (1A6)Species Reactivity: HumanHost/Isotype : Mouse / IgG2a, kappaClass:MonoclonalType : AntibodyClone: 1A6Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer: PBS, pH 7.4Contains :…
Product Name : TFF3 Monoclonal Antibody (OTI4D10), TrueMAB™Species Reactivity: HumanHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: OTI4D10Conjugate : UnconjugatedForm: lyophilizedConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH 7.3,…
Product Name : TER-119 Monoclonal Antibody (TER-119), PESpecies Reactivity: MouseHost/Isotype : Rat / IgG2bClass:MonoclonalType : AntibodyClone: TER-119Conjugate : PE View additional formats APC FITC UnconjugatedForm: LiquidConcentration : 0.2 mg/mLPurification :…
Name : TRERF1 (Human) Recombinant Protein (Q01) Biological Activity : Human TRERF1 partial ORF (NP_060885.1, 2 a.a. – 90 a.a.) recombinant protein with GST-tag at N-terminal. Tag : Best use…
Product Name : INO80 complex subunit BTarget gene : INO80Bverified_species_reactivity : Humaninterspecies_information : 95%, ENSMUSG00000030034, species_id: MOUSE, 96%, ENSRNOG00000057972, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : Ibentatug BiosimilarHost species : ChimericSpecies reactivity : HumanForm: LiquidStorage buffer : 0.01M PBS, pH 7.4.Concentration: 1 mg/mlPurity : >95% by SDS-PAGE.Clonality: MonoclonalApplications : Research Grade BiosimilarTarget :…
Product Name : interleukin 20 receptor, alphaTarget gene : IL20RAverified_species_reactivity : Humaninterspecies_information : 80%, ENSMUSG00000020007, species_id: MOUSE, 76%, ENSRNOG00000012286, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : TCR V beta 8a Monoclonal Antibody (16G8), FITCSpecies Reactivity: Human, Non-human primateHost/Isotype : Mouse / IgG2bClass:MonoclonalType : AntibodyClone: 16G8Conjugate : FITCForm: LiquidConcentration : 0.15 mg/mLPurification : Protein…
Name : COL19A1 (Human) Recombinant Protein (Q01) Biological Activity : Human COL19A1 partial ORF ( NP_001849, 27 a.a. – 114 a.a.) recombinant protein with GST-tag at N-terminal. Tag : Best…
Product Name : acyl-CoA synthetase medium-chain family member 5Target gene : ACSM5verified_species_reactivity : Humaninterspecies_information : 64%, ENSMUSG00000030972, species_id: MOUSE, 58%, ENSRNOG00000031211, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer :…
Product Name : TCF7 Monoclonal Antibody (1B3)Species Reactivity: HumanHost/Isotype : Mouse / IgG1, kappaClass:MonoclonalType : AntibodyClone: 1B3Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer: PBS, pH 7.4Contains :…
Name : CCDC40 (Human) Recombinant Protein (P01) Biological Activity : Human CCDC40 full-length ORF ( XP_939608.1, 1 a.a. – 478 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength…
Product Name : heat shock 70kDa protein 12ATarget gene : HSPA12Averified_species_reactivity : Humaninterspecies_information : 95%, ENSMUSG00000025092, species_id: MOUSE, 96%, ENSRNOG00000018019, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40%…
Product Name : TACC3 Monoclonal Antibody (OTI8B7), TrueMAB™Species Reactivity: HumanHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: OTI8B7Conjugate : UnconjugatedForm: lyophilizedConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH 7.3,…
Name : ARL15 (Human) Recombinant Protein (P01) Biological Activity : Human ARL15 full-length ORF ( NP_061960.1, 1 a.a. – 204 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength…
Product Name : 5-hydroxymethylcytosine (hmC) binding, ES cell-specificTarget gene : HMCESverified_species_reactivity : Humaninterspecies_information : 87%, ENSMUSG00000030060, species_id: MOUSE, 88%, ENSRNOG00000010474, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40%…
Product Name : Synaptotagmin-11 Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.13 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH…
Name : CPVL (Human) Recombinant Protein (P01) Biological Activity : Human CPVL full-length ORF ( AAH16838.1, 1 a.a. – 476 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength…
Product Name : HECT domain containing E3 ubiquitin protein ligase 1Target gene : HECTD1verified_species_reactivity : Humaninterspecies_information : 97%, ENSMUSG00000035247, species_id: MOUSE, 96%, ENSRNOG00000006905, species_id: RATclonality : Polyclonalisotype : IgGhost :…
Product Name : Streptococcus Group A Monoclonal Antibody (HSA12-340.5)Species Reactivity: BacteriaHost/Isotype : Mouse / IgG2aClass:MonoclonalType : AntibodyClone: HSA12-340.5Conjugate : UnconjugatedForm: LiquidConcentration : 1.56 mg/mLPurification : Protein GStorage buffer: PBS, pH…
Product Name : gasdermin CTarget gene : GSDMCverified_species_reactivity : Humaninterspecies_information : 34%, ENSMUSG00000056293, species_id: MOUSE, 36%, ENSRNOG00000054576, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and PBS…
Product Name : Stathmin Polyclonal AntibodySpecies Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: liquidConcentration : 1 mg/mLPurification : Antigen affinity chromatographyStorage buffer: phosphate/tris citrate, pH…
Product Name : G protein-coupled receptor 26Target gene : GPR26verified_species_reactivity : Humaninterspecies_information : 100%, ENSMUSG00000040125, species_id: MOUSE, 100%, ENSRNOG00000047057, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : Sigma-1 Receptor Polyclonal AntibodySpecies Reactivity: Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.25 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH…
Product Name : golgin B1Target gene : GOLGB1verified_species_reactivity : Humaninterspecies_information : 69%, ENSMUSG00000034243, species_id: MOUSE, 67%, ENSRNOG00000030314, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and PBS…
Product Name : Sam50 Monoclonal Antibody (2H6H9)Species Reactivity: Human, Mouse, Pig, RatHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: 2H6H9Conjugate : Unconjugated View additional formats CoraLite 594Form: LiquidConcentration : 1000 µg/mLPurification…
Product Name : gastric inhibitory polypeptideTarget gene : GIPverified_species_reactivity : Humaninterspecies_information : 66%, ENSMUSG00000014351, species_id: MOUSE, 69%, ENSRNOG00000006306, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and…
Product Name : SYCP3 Monoclonal Antibody (OTI1B11), TrueMAB™Species Reactivity: HumanHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: OTI1B11Conjugate : UnconjugatedForm: liquidConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS with 1%…
Product Name : gem (nuclear organelle) associated protein 4Target gene : GEMIN4verified_species_reactivity : Humaninterspecies_information : 84%, ENSMUSG00000049396, species_id: MOUSE, 82%, ENSRNOG00000055236, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer :…
Product Name : SUMO1 Polyclonal Antibody, MaxPab™Species Reactivity: HumanHost/Isotype : Mouse / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer: PBS, pH 7.4Contains : no…
Product Name : GTPase activating protein (SH3 domain) binding protein 2Target gene : G3BP2verified_species_reactivity : Humaninterspecies_information : 94%, ENSMUSG00000029405, species_id: MOUSE, 92%, ENSRNOG00000002433, species_id: RATclonality : Polyclonalisotype : IgGhost :…
Product Name : SULT1A1 Monoclonal Antibody (OTI5F1), TrueMAB™Species Reactivity: HumanHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: OTI5F1Conjugate : UnconjugatedForm: lyophilizedConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH 7.3,…
Product Name : forkhead box P3Target gene : FOXP3verified_species_reactivity : Humaninterspecies_information : 90%, ENSMUSG00000039521, species_id: MOUSE, 88%, ENSRNOG00000011702, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and…
Product Name : STK11IP Polyclonal Antibody, MaxPab™Species Reactivity: HumanHost/Isotype : Mouse / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer: PBS, pH 7.4Contains : no…
Product Name : fibroblast growth factor 9Target gene : FGF9verified_species_reactivity : Humaninterspecies_information : 98%, ENSMUSG00000021974, species_id: MOUSE, 98%, ENSRNOG00000011471, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : STAT5A Monoclonal Antibody (OTI3F9), TrueMAB™Species Reactivity: HumanHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: OTI3F9Conjugate : UnconjugatedForm: lyophilizedConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH 7.3,…
Product Name : F-box protein 8Target gene : FBXO8verified_species_reactivity : Humaninterspecies_information : 92%, ENSMUSG00000038206, species_id: MOUSE, 92%, ENSRNOG00000010502, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and…
Product Name : ST2 (IL1RL1) Monoclonal Antibody (OTI1H1), TrueMAB™Species Reactivity: HumanHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: OTI1H1Conjugate : UnconjugatedForm: LyophilizedConcentration : See LabelPurification : Protein A/GStorage buffer: PBS, pH…
Product Name : family with sequence similarity 227, member BTarget gene : FAM227Bverified_species_reactivity : Humaninterspecies_information : 54%, ENSMUSG00000027209, species_id: MOUSE, 50%, ENSRNOG00000037124, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer…
Product Name : SSH3 Polyclonal AntibodySpecies Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.45 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH 7.3,…
Product Name : family with sequence similarity 117, member BTarget gene : FAM117Bverified_species_reactivity : Humaninterspecies_information : 94%, ENSMUSG00000041040, species_id: MOUSE, 94%, ENSRNOG00000022066, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer…
Product Name : F2R like thrombin or trypsin receptor 3Target gene : F2RL3verified_species_reactivity : Humaninterspecies_information : 52%, ENSMUSG00000050147, species_id: MOUSE, 48%, ENSRNOG00000048186, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer…
Product Name : SPOCK3 Polyclonal Antibody, MaxPab™Species Reactivity: HumanHost/Isotype : Mouse / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : See LabelPurification : Affinity chromatographyStorage buffer: PBS, pH 7.4Contains :…
Product Name : adipogenesis associated, Mth938 domain containingTarget gene : AAMDCverified_species_reactivity : Humaninterspecies_information : 89%, ENSMUSG00000035642, species_id: MOUSE, 89%, ENSRNOG00000012584, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40%…
Product Name : SPG7 Polyclonal Antibody, MaxPab™Species Reactivity: HumanHost/Isotype : Mouse / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : See LabelPurification : Affinity chromatographyStorage buffer: PBS, pH 7.4Contains :…
Product Name : eukaryotic translation initiation factor 2B, subunit 2 beta, 39kDaTarget gene : EIF2B2verified_species_reactivity : Humaninterspecies_information : 97%, ENSMUSG00000004788, species_id: MOUSE, 96%, ENSRNOG00000006467, species_id: RATclonality : Polyclonalisotype : IgGhost…
Product Name : SP140L Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.27 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH 7.3, with…
Product Name : SOX17 Monoclonal Antibody (OTI3H5)Species Reactivity: Dog, HumanHost/Isotype : Mouse / IgG2aClass:MonoclonalType : AntibodyClone: OTI3H5Conjugate : UnconjugatedForm: LiquidConcentration : 0.61 mg/mLPurification : Affinity ChromatographyStorage buffer: PBS, pH 7.3,…
Product Name : estrogen receptor binding site associated, antigen, 9Target gene : EBAG9verified_species_reactivity : Humaninterspecies_information : 97%, ENSMUSG00000022339, species_id: MOUSE, 95%, ENSRNOG00000004220, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer…
Product Name : SOAT2 Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.44 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH 7.3, with…
Product Name : double C2-like domains, alphaTarget gene : DOC2Averified_species_reactivity : Humaninterspecies_information : 93%, ENSMUSG00000052301, species_id: MOUSE, 93%, ENSRNOG00000019920, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : SNAP23 Recombinant Rabbit Monoclonal Antibody (JA73-15)Species Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: JA73-15Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage…
Product Name : SMPD2 Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH 7.4,…
Name : HSPC121 (Human) Recombinant Protein (Q01) Biological Activity : Human HSPC121 partial ORF ( NP_057479, 1 a.a. – 113 a.a.) recombinant protein with GST-tag at N-terminal. Tag : Best…
Product Name : Sry-box 21Target gene : SOX21verified_species_reactivity : Humaninterspecies_information : 100%, ENSRNOG00000052579, species_id: RAT, 100%, ENSMUSG00000061517, species_id: MOUSEclonality : Monoclonalisotype : IgG1host : Mousebuffer : The antibodies are delivered…
Product Name : SMAD3 Monoclonal Antibody (4G12)Species Reactivity: HumanHost/Isotype : Mouse / IgG2a, kappaClass:MonoclonalType : AntibodyClone: 4G12Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer: PBS, pH 7.4Contains :…
Product Name : dermcidinTarget gene : DCDverified_species_reactivity : Humaninterspecies_information : 27%, ENSMUSG00000027488, species_id: MOUSE, 28%, ENSRNOG00000006846, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and PBS (pH…
Product Name : SLIRP/C14orf156 Polyclonal Antibody, Cyanine3Species Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : Cyanine3Form: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: TBS with 1%…
Product Name : SLC46A1 Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: liquidConcentration : 1 mg/mLPurification : Antigen affinity chromatographyStorage buffer: tris citrate/phosphate, pH 7-8Contains…
Product Name : CWF19-like 1, cell cycle control (S. pombe)Target gene : CWF19L1verified_species_reactivity : Humaninterspecies_information : 91%, ENSMUSG00000025200, species_id: MOUSE, 91%, ENSRNOG00000012763, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer…
Product Name : SIN3A Recombinant Rabbit Monoclonal Antibody (3W9A10)Species Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: 3W9A10Conjugate : UnconjugatedForm: LiquidConcentration : 0.53 mg/mLPurification : Affinity chromatographyStorage…
Product Name : crystallin, gamma NTarget gene : CRYGNverified_species_reactivity : Humaninterspecies_information : 42%, ENSMUSG00000038135, species_id: MOUSE, 42%, ENSRNOG00000009226, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and…
Product Name : SHMT2 Monoclonal Antibody (5E7)Species Reactivity: HumanHost/Isotype : Mouse / IgG2a, kappaClass:MonoclonalType : AntibodyClone: 5E7Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer: PBS, pH 7.4Contains :…
Product Name : carboxypeptidase A2 (pancreatic)Target gene : CPA2verified_species_reactivity : Humaninterspecies_information : 75%, ENSMUSG00000071553, species_id: MOUSE, 82%, ENSRNOG00000028092, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and…
Product Name : SHARPIN Monoclonal Antibody (3A9E2)Species Reactivity: HumanHost/Isotype : Mouse / IgG2aClass:MonoclonalType : AntibodyClone: 3A9E2Conjugate : UnconjugatedForm: LiquidConcentration : 1000 µg/mLPurification : Protein AStorage buffer: PBS, pH 7.3, with…
Product Name : clusterin associated protein 1Target gene : CLUAP1verified_species_reactivity : Humaninterspecies_information : 89%, ENSMUSG00000014232, species_id: MOUSE, 90%, ENSRNOG00000007117, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : SFTPA1 Monoclonal Antibody (C5)Species Reactivity: HumanHost/Isotype : Mouse / IgG1, kappaClass:MonoclonalType : AntibodyClone: C5Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein A/GStorage buffer: PBS with 50%…
Product Name : cell death-inducing DFFA-like effector cTarget gene : CIDECverified_species_reactivity : Humaninterspecies_information : 81%, ENSMUSG00000030278, species_id: MOUSE, 83%, ENSRNOG00000009153, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40%…
Product Name : SF3B2 Monoclonal Antibody (2A2)Species Reactivity: HumanHost/Isotype : Mouse / IgG2a, kappaClass:MonoclonalType : AntibodyClone: 2A2Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer: PBS, pH 7.4Contains :…
Product Name : coiled-coil-helix-coiled-coil-helix domain containing 2Target gene : CHCHD2verified_species_reactivity : Humaninterspecies_information : 70%, ENSMUSG00000034173, species_id: MOUSE, 70%, ENSRNOG00000000918, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : SERPINB6 Polyclonal AntibodySpecies Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.24 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH 7.3,…
Product Name : cilia and flagella associated protein 57Target gene : CFAP57verified_species_reactivity : Humaninterspecies_information : 78%, ENSMUSG00000028730, species_id: MOUSE, 21%, ENSRNOG00000028077, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer :…
Product Name : SEC22L2 Polyclonal Antibody, MaxPab™Species Reactivity: HumanHost/Isotype : Mouse / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer: PBS, pH 7.4Contains : no…
Product Name : cadherin 26Target gene : CDH26verified_species_reactivity : Humaninterspecies_information : 25%, ENSMUSG00000079259, species_id: MOUSE, 26%, ENSRNOG00000053332, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and PBS…
Product Name : SDS Monoclonal Antibody (OTI1H5), TrueMAB™Species Reactivity: HumanHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: OTI1H5Conjugate : UnconjugatedForm: lyophilizedConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH 7.3,…
Product Name : chemokine (C-C motif) receptor 6Target gene : CCR6verified_species_reactivity : Humaninterspecies_information : 64%, ENSMUSG00000040899, species_id: MOUSE, 64%, ENSRNOG00000012964, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40%…
Product Name : SCRG1 Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.31 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH…
Product Name : coiled-coil domain containing 173Target gene : CCDC173verified_species_reactivity : Humaninterspecies_information : 73%, ENSMUSG00000070883, species_id: MOUSE, 70%, ENSRNOG00000052954, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : SCEL Monoclonal Antibody (4B12)Species Reactivity: HumanHost/Isotype : Mouse / IgG2b, kappaClass:MonoclonalType : AntibodyClone: 4B12Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer: PBS, pH 7.4Contains :…
Product Name : Leucine rich repeat containing g protein-coupled receptor 5Target gene : LGR5verified_species_reactivity : Humaninterspecies_information : 87%, ENSRNOG00000004221, species_id: RAT, 91%, ENSMUSG00000020140, species_id: MOUSEclonality : Monoclonalisotype : IgG2ahost :…
Product Name : SARS/SARS-CoV-2 Nucleocapsid Polyclonal AntibodySpecies Reactivity: VirusHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.33 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH 7,…
Product Name : cullin-associated and neddylation-dissociated 1Target gene : CAND1verified_species_reactivity : Humaninterspecies_information : 100%, ENSMUSG00000020114, species_id: MOUSE, 100%, ENSRNOG00000007834, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : SARS-CoV-2 Spike Protein S2 Polyclonal AntibodySpecies Reactivity: VirusHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBSContains…
Product Name : chromosome 4 open reading frame 3Target gene : C4orf3verified_species_reactivity : Humaninterspecies_information : 62%, ENSMUSG00000054091, species_id: MOUSE, 52%, ENSRNOG00000014654, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer :…
Product Name : SARS-CoV-2 N Protein Monoclonal Antibody (OTI9F7), TrueMAB™Species Reactivity: VirusHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: OTI9F7Conjugate : UnconjugatedForm: LyophilizedConcentration : See LabelPurification : Protein A/GStorage buffer: PBS,…
Product Name : chromosome 21 open reading frame 59Target gene : C21orf59verified_species_reactivity : Humaninterspecies_information : 95%, ENSMUSG00000022972, species_id: MOUSE, 93%, ENSRNOG00000021399, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer :…
Product Name : SAE1 Monoclonal Antibody (1G4-1G5)Species Reactivity: HumanHost/Isotype : Mouse / IgG1, lambdaClass:MonoclonalType : AntibodyClone: 1G4-1G5Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer: PBS, pH 7.4Contains :…
Product Name : S100B Monoclonal Antibody (OTI2H10), TrueMAB™Species Reactivity: HumanHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: OTI2H10Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein A/GStorage buffer: PBS with 50%…
Product Name : BTG family, member 3Target gene : BTG3verified_species_reactivity : Humaninterspecies_information : 90%, ENSMUSG00000044645, species_id: MOUSE, 90%, ENSRNOG00000001555, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : S100A11 Recombinant Rabbit Monoclonal Antibody (118)Species Reactivity: HumanHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: 118Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBSContains…
Product Name : bone morphogenetic protein 8bTarget gene : BMP8Bverified_species_reactivity : Humaninterspecies_information : 85%, ENSMUSG00000002384, species_id: MOUSE, 82%, ENSRNOG00000033209, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : Ring1B Monoclonal Antibody (3-3)Species Reactivity: Human, Mouse, Non-human primateHost/Isotype : Mouse / IgG2bClass:MonoclonalType : AntibodyClone: 3-3Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein GStorage buffer: 70mM…
Product Name : B9 protein domain 2Target gene : B9D2verified_species_reactivity : Humaninterspecies_information : 98%, ENSMUSG00000063439, species_id: MOUSE, 95%, ENSRNOG00000028753, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : Rb Recombinant Rabbit Monoclonal Antibody (2R4M3)Species Reactivity: Mouse, RatHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: 2R4M3Conjugate : UnconjugatedForm: LiquidConcentration : 0.21 mg/mLPurification : Affinity chromatographyStorage buffer:…
Product Name : zinc finger and SCAN domain containing 5ATarget gene : ZSCAN5Averified_species_reactivity : Humaninterspecies_information : 35%, ENSMUSG00000051390, species_id: MOUSE, 38%, ENSRNOG00000007349, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer…
Product Name : RUNX3 Monoclonal Antibody (A7B7)Species Reactivity: Human, RatHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: A7B7Conjugate : UnconjugatedForm: LiquidConcentration : 2 mg/mLPurification : Protein AStorage buffer: PBS, pH 7.4,…
Product Name : zinc finger protein 622Target gene : ZNF622verified_species_reactivity : Humaninterspecies_information : 96%, ENSMUSG00000052253, species_id: MOUSE, 96%, ENSRNOG00000059443, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : RS1 Polyclonal AntibodySpecies Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.27 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH 7.3,…
Product Name : zinc finger protein 48Target gene : ZNF48verified_species_reactivity : Humaninterspecies_information : 61%, ENSMUSG00000045598, species_id: MOUSE, 68%, ENSRNOG00000017837, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : RPS6KB1 Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS with 50%…
Product Name : zinc finger protein 319Target gene : ZNF319verified_species_reactivity : Humaninterspecies_information : 99%, ENSMUSG00000046556, species_id: MOUSE, 99%, ENSRNOG00000013460, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : RPL13 Recombinant Rabbit Monoclonal Antibody (JE62-34)Species Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: JE62-34Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage…
Product Name : zinc finger, CCHC domain containing 7Target gene : ZCCHC7verified_species_reactivity : Humaninterspecies_information : 66%, ENSMUSG00000035649, species_id: MOUSE, 64%, ENSRNOG00000013078, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer :…
Product Name : zinc finger and BTB domain containing 41Target gene : ZBTB41verified_species_reactivity : Humaninterspecies_information : 93%, ENSMUSG00000033964, species_id: MOUSE, 95%, ENSRNOG00000011137, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer…
Product Name : RNF36 Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS with 50%…
Product Name : YY1 associated factor 2Target gene : YAF2verified_species_reactivity : Humaninterspecies_information : 89%, ENSMUSG00000022634, species_id: MOUSE, 90%, ENSRNOG00000004773, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : RNF146 Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS with 1%…
Product Name : WD repeat domain 77Target gene : WDR77verified_species_reactivity : Humaninterspecies_information : 92%, ENSMUSG00000000561, species_id: MOUSE, 95%, ENSRNOG00000016394, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : VGF nerve growth factor inducibleTarget gene : VGFverified_species_reactivity : Humaninterspecies_information : 90%, ENSMUSG00000037428, species_id: MOUSE, 89%, ENSRNOG00000001416, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40%…
Product Name : Efzimfotase Alfa BiosimilarHost species : Species reactivity : HumanForm: LiquidStorage buffer : 0.01M PBS, pH 7.4.Concentration: 1 mg/mlPurity : >95% by SDS-PAGE.Clonality: MonoclonalApplications : Research Grade BiosimilarTarget…
Product Name : uridine phosphorylase 2Target gene : UPP2verified_species_reactivity : Humaninterspecies_information : 83%, ENSMUSG00000026839, species_id: MOUSE, 74%, ENSRNOG00000005341, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and…
Product Name : Anti-Human MAPT/Tau/PHF-tau BiosimilarHost species : HumanSpecies reactivity : HumanForm: LiquidStorage buffer : 0.01M PBS, pH 7.4.Concentration: 1 mg/mlPurity : >95% by SDS-PAGE.Clonality: MonoclonalApplications : Research Grade BiosimilarTarget…
Product Name : uridine-cytidine kinase 1-like 1Target gene : UCKL1verified_species_reactivity : Humaninterspecies_information : 99%, ENSMUSG00000089917, species_id: MOUSE, 99%, ENSRNOG00000050277, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : thioredoxin domain containing 17Target gene : TXNDC17verified_species_reactivity : Humaninterspecies_information : 76%, ENSMUSG00000020803, species_id: MOUSE, 73%, ENSRNOG00000014072, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : tuberous sclerosis 2Target gene : TSC2verified_species_reactivity : Humaninterspecies_information : 92%, ENSMUSG00000002496, species_id: MOUSE, 93%, ENSRNOG00000011375, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and…
Product Name : tripartite motif containing 29Target gene : TRIM29verified_species_reactivity : Humaninterspecies_information : 84%, ENSMUSG00000032013, species_id: MOUSE, 85%, ENSRNOG00000021771, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : Golgi protein 58k Polyclonal AntibodySpecies Reactivity: Human, Mouse, PigHost/Isotype : Goat / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.5 mg/mLPurification : Ammonium sulfate precipitationStorage buffer:…
Product Name : tumor necrosis factor receptor superfamily, member 8Target gene : TNFRSF8verified_species_reactivity : Humaninterspecies_information : 42%, ENSMUSG00000028602, species_id: MOUSE, 38%, ENSRNOG00000016782, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer…
Product Name : GluR3 Monoclonal Antibody (3B3)Species Reactivity: Human, Non-human primate, RatHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: 3B3Conjugate : UnconjugatedForm: LiquidConcentration : 0.5 mg/mLPurification : Protein AStorage buffer: PBS,…
Product Name : acetyl-CoA acyltransferase 1Target gene : ACAA1verified_species_reactivity : Humaninterspecies_information : 88%, ENSMUSG00000010651, species_id: MOUSE, 87%, ENSRNOG00000032908, species_id: RATclonality : Monoclonalisotype : IgG1host : Mousebuffer : 40% glycerol and…
Product Name : Gata-3 Monoclonal Antibody (TWAJ), Alexa Fluor™ 700, eBioscience™Species Reactivity: Human, Mouse, Pig, Rhesus monkeyHost/Isotype : Rat / IgG2b, kappaClass:MonoclonalType : AntibodyClone: TWAJConjugate : Alexa Fluor™ 700 View…
Product Name : transmembrane protein 102Target gene : TMEM102verified_species_reactivity : Humaninterspecies_information : 66%, ENSMUSG00000089876, species_id: MOUSE, 62%, ENSRNOG00000015057, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and…
Product Name : GUCY1A1 Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : affinity chromatographyStorage buffer: PBS, pH 7.4,…
Product Name : translocase of inner mitochondrial membrane domain containing 1Target gene : TIMMDC1verified_species_reactivity : Humaninterspecies_information : 53%, ENSMUSG00000002846, species_id: MOUSE, 53%, ENSRNOG00000002999, species_id: RATclonality : Polyclonalisotype : IgGhost :…
Product Name : GSTT1 Monoclonal Antibody (1A4C11), CoraLite® Plus 488Species Reactivity: Human, MouseHost/Isotype : Mouse / IgG2bClass:MonoclonalType : AntibodyClone: 1A4C11Conjugate : CoraLite® Plus 488 View additional formats CoraLite 594 UnconjugatedForm:…
Product Name : testis expressed 15Target gene : TEX15verified_species_reactivity : Humaninterspecies_information : 43%, ENSMUSG00000009628, species_id: MOUSE, 38%, ENSRNOG00000007748, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and…
Product Name : GSK3 alpha/beta Polyclonal AntibodySpecies Reactivity: Human, Mouse, Non-human primate, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer:…
Product Name : transducin beta like 1 Y-linkedTarget gene : TBL1Yverified_species_reactivity : Humaninterspecies_information : 58%, ENSMUSG00000025246, species_id: MOUSE, 58%, ENSRNOG00000003686, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40%…
Product Name : GPT2 Polyclonal Antibody, MaxPab™Species Reactivity: HumanHost/Isotype : Mouse / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer: PBS, pH 7.4Contains : no…
Product Name : Rho guanine nucleotide exchange factor (GEF) 35Target gene : ARHGEF35verified_species_reactivity : Humaninterspecies_information : 48%, ENSMUSG00000033542, species_id: MOUSE, 55%, ENSRNOG00000005506, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer…
Product Name : GPR91 (SUCNR1) (extracellular) Polyclonal Antibody, FITCSpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : FITCForm: LyophilizedConcentration : 1 mg/mLPurification : Antigen affinity chromatographyStorage…
Product Name : striatin interacting protein 1Target gene : STRIP1verified_species_reactivity : Humaninterspecies_information : 100%, ENSMUSG00000014601, species_id: MOUSE, 100%, ENSRNOG00000018293, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : GPR137B Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.17 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH 7.3, with…
Product Name : SRR1 domain containingTarget gene : SRRDverified_species_reactivity : Humaninterspecies_information : 62%, ENSMUSG00000029346, species_id: MOUSE, 62%, ENSRNOG00000000662, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and…
Product Name : GORAB Monoclonal Antibody (OTI4F11)Species Reactivity: HumanHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: OTI4F11Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Affinity ChromatographyStorage buffer: PBS, pH 7.3, with…
Product Name : spermatogenesis and centriole associated 1-likeTarget gene : SPATC1Lverified_species_reactivity : Humaninterspecies_information : 77%, ENSMUSG00000009115, species_id: MOUSE, 77%, ENSRNOG00000045929, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40%…
Product Name : GNMT Monoclonal Antibody (1B5E3)Species Reactivity: Human, Mouse, Pig, RatHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: 1B5E3Conjugate : UnconjugatedForm: LiquidConcentration : 1000 µg/mLPurification : Protein AStorage buffer: PBS,…
Product Name : sorting nexin 16Target gene : SNX16verified_species_reactivity : Humaninterspecies_information : 62%, ENSMUSG00000027534, species_id: MOUSE, 64%, ENSRNOG00000009953, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and…
Product Name : Anti-Human CD223/LAG3 BiosimilarHost species : HumanSpecies reactivity : HumanForm: LiquidStorage buffer : 0.01M PBS, pH 7.4.Concentration: 1 mg/mlPurity : >95% by SDS-PAGE.Clonality: MonoclonalApplications : Research Grade BiosimilarTarget…
Product Name : snail family transcriptional repressor 1Target gene : SNAI1verified_species_reactivity : Humaninterspecies_information : 82%, ENSMUSG00000042821, species_id: MOUSE, 84%, ENSRNOG00000009594, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40%…
Product Name : Anti-Human F11 BiosimilarHost species : HumanSpecies reactivity : HumanForm: LiquidStorage buffer : 0.01M PBS, pH 7.4.Concentration: 1 mg/mlPurity : >95% by SDS-PAGE.Clonality: MonoclonalApplications : Research Grade BiosimilarTarget…
Product Name : solute carrier family 38, member 6Target gene : SLC38A6verified_species_reactivity : Humaninterspecies_information : 71%, ENSMUSG00000044712, species_id: MOUSE, 76%, ENSRNOG00000022622, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer :…
Product Name : Eflimrufusp Alfa BiosimilarHost species : Species reactivity : HumanForm: LiquidStorage buffer : 0.01M PBS, pH 7.4.Concentration: 1 mg/mlPurity : >95% by SDS-PAGE.Clonality: Applications : Research Grade BiosimilarTarget…
Product Name : solute carrier family 34 (type II sodium/phosphate contransporter), member 2Target gene : SLC34A2verified_species_reactivity : Humaninterspecies_information : 57%, ENSMUSG00000029188, species_id: MOUSE, 59%, ENSRNOG00000004626, species_id: RATclonality : Polyclonalisotype :…
Product Name : Anti-Human VSIR/VISTA Antibody BiosimilarHost species : HumanSpecies reactivity : HumanForm: LiquidStorage buffer : 0.01M PBS, pH 7.4.Concentration: 3.88 mg/mlPurity : >95% by SDS-PAGE.Clonality: MonoclonalApplications : Research Grade…
Product Name : apolipoprotein MTarget gene : APOMverified_species_reactivity : Humaninterspecies_information : 80%, ENSMUSG00000024391, species_id: MOUSE, 81%, ENSRNOG00000000850, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and PBS…
Product Name : serine hydroxymethyltransferase 1Target gene : SHMT1verified_species_reactivity : Humaninterspecies_information : 73%, ENSMUSG00000020534, species_id: MOUSE, 75%, ENSRNOG00000005275, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and…
Product Name : apolipoprotein BTarget gene : APOBverified_species_reactivity : Humaninterspecies_information : 76%, ENSMUSG00000020609, species_id: MOUSE, 78%, ENSRNOG00000005542, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and PBS…
Product Name : PF-5190457Description:PF-5190457 (PF-05190457) is a potent and selective ghrelin receptor inverse agonist with a pKi of 8.36.CAS: 1334782-79-4Molecular Weight:512.67Formula: C29H32N6OSChemical Name: 2-2-methylimidazothiazol-6-yl-1-2--2,7-diazaspirononan-7-ylethan-1-oneSmiles : CC1C=C(N=CN=1)C1=CC2CC(C=2C=C1)N1CC2(C1)CCN(CC2)C(=O)CC1=CN2C=C(C)SC2=N1InChiKey: ZIUDADZJCKGWKR-AREMUKBSSA-NInChi : InChI=1S/C29H32N6OS/c1-19-11-25(31-18-30-19)22-3-5-24-21(12-22)4-6-26(24)35-16-29(17-35)7-9-33(10-8-29)27(36)13-23-15-34-14-20(2)37-28(34)32-23/h3,5,11-12,14-15,18,26H,4,6-10,13,16-17H2,1-2H3/t26-/m1/s1Purity: ≥98%…
Product Name : SDA1 domain containing 1Target gene : SDAD1verified_species_reactivity : Humaninterspecies_information : 99%, ENSMUSG00000029415, species_id: MOUSE, 99%, ENSRNOG00000022229, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : Ro-51Description:Ro-51 is a potent and selective dual P2X3/P2X2/3 antagonist, with IC50 of 2 nM and 5 nM for P2X3 and P2X2/3, respectively. Ro-51 can be used for…
Product Name : SET binding factor 1Target gene : SBF1verified_species_reactivity : Humaninterspecies_information : 89%, ENSMUSG00000036529, species_id: MOUSE, 89%, ENSRNOG00000008392, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : UndisclosedTarget points: NovamabStatus: Organization : Short name : Type: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light…
Product Name : ribosome binding protein 1Target gene : RRBP1verified_species_reactivity : Humaninterspecies_information : 77%, ENSMUSG00000027422, species_id: MOUSE, 78%, ENSRNOG00000005958, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : PD-L1Target points: Betta PharmaStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of…
Product Name : ring finger protein 32Target gene : RNF32verified_species_reactivity : Humaninterspecies_information : 65%, ENSMUSG00000029130, species_id: MOUSE, 66%, ENSRNOG00000005691, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : CD98Target points: Huahui HealthStatus: CD98Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of…
Product Name : RIO kinase 3Target gene : RIOK3verified_species_reactivity : Humaninterspecies_information : 96%, ENSMUSG00000024404, species_id: MOUSE, 97%, ENSRNOG00000023376, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and…
Product Name : UndisclosedTarget points: JemincareStatus: Organization : Short name : Type: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light…
Product Name : raftlin, lipid raft linker 1Target gene : RFTN1verified_species_reactivity : Humaninterspecies_information : 71%, ENSMUSG00000039316, species_id: MOUSE, 68%, ENSRNOG00000011321, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40%…
Product Name : 4-1BBPD-L1Target points: Anke BiotechnologyHefei HankemabStatus: Organization : Short name : Type: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of…
Product Name : RNA binding motif protein 44Target gene : RBM44verified_species_reactivity : Humaninterspecies_information : 47%, ENSMUSG00000070732, species_id: MOUSE, 43%, ENSRNOG00000024878, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40%…
Product Name : ACEI Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS with 1%…
Product Name : Rap guanine nucleotide exchange factor 2Target gene : RAPGEF2verified_species_reactivity : Humaninterspecies_information : 94%, ENSMUSG00000062232, species_id: MOUSE, 94%, ENSRNOG00000021581, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer :…
Product Name : CD3Target points: XenikosStatus: CD3Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two…
Product Name : protein tyrosine phosphatase, receptor type, FTarget gene : PTPRFverified_species_reactivity : Humaninterspecies_information : 90%, ENSMUSG00000033295, species_id: MOUSE, 92%, ENSRNOG00000019977, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer :…
Product Name : VEGFTarget points: FormyconStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two…
Product Name : proteasome (prosome, macropain) subunit, beta type, 4Target gene : PSMB4verified_species_reactivity : Humaninterspecies_information : 98%, ENSMUSG00000005779, species_id: MOUSE, 96%, ENSRNOG00000020979, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer…
Product Name : UndisclosedTarget points: AlphamabStatus: Organization : Short name : Type: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light…
Product Name : phosphoribosyl pyrophosphate synthetase 1Target gene : PRPS1verified_species_reactivity : Humaninterspecies_information : 36%, ENSMUSG00000002100, species_id: MOUSE, 39%, ENSRNOG00000028627, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : PD-1Target points: National Institutes of HealthStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies…
Product Name : protein phosphatase 1, regulatory subunit 15ATarget gene : PPP1R15Averified_species_reactivity : Humaninterspecies_information : 49%, ENSMUSG00000040435, species_id: MOUSE, 46%, ENSRNOG00000020938, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer :…
Product Name : NGFTarget points: Sichuan UniversityStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of…
Product Name : phosphoribosyl pyrophosphate amidotransferaseTarget gene : PPATverified_species_reactivity : Humaninterspecies_information : 97%, ENSMUSG00000029246, species_id: MOUSE, 97%, ENSRNOG00000002128, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and…
Product Name : Interleukin 23Target points: VHsquaredStatus: Interleukin 23Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist…
Product Name : proline-rich nuclear receptor coactivator 1Target gene : PNRC1verified_species_reactivity : Humaninterspecies_information : 92%, ENSMUSG00000040128, species_id: MOUSE, 91%, ENSRNOG00000007793, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40%…
Product Name : GP88Target points: LundbeckStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two…
Product Name : plakophilin 2Target gene : PKP2verified_species_reactivity : Humaninterspecies_information : 65%, ENSMUSG00000041957, species_id: MOUSE, 41%, ENSRNOG00000001825, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and PBS…
Product Name : APC membrane recruitment protein 1Target gene : AMER1verified_species_reactivity : Humaninterspecies_information : 90%, ENSMUSG00000050332, species_id: MOUSE, 90%, ENSRNOG00000007984, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40%…
Product Name : CD40UndisclosedTarget points: Quine MedicalStatus: Organization : Short name : Type: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two…
Product Name : pyridoxal (pyridoxine, vitamin B6) phosphataseTarget gene : PDXPverified_species_reactivity : Humaninterspecies_information : 92%, ENSMUSG00000022436, species_id: MOUSE, 93%, ENSRNOG00000009570, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40%…
Product Name : CD19Target points: Sloan Kettering InstituteStatus: CD19Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist…
Product Name : alpha-kinase 2Target gene : ALPK2verified_species_reactivity : Humaninterspecies_information : 34%, ENSMUSG00000032845, species_id: MOUSE, 35%, ENSRNOG00000017421, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and PBS…
Product Name : poly (ADP-ribose) glycohydrolaseTarget gene : PARGverified_species_reactivity : Humaninterspecies_information : 97%, ENSMUSG00000021911, species_id: MOUSE, 95%, ENSRNOG00000019978, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and…
Product Name : PD-L1OX40Target points: InnoventStatus: Organization : Short name : Type: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light…
Product Name : peptidyl arginine deiminase, type ITarget gene : PADI1verified_species_reactivity : Humaninterspecies_information : 82%, ENSMUSG00000025329, species_id: MOUSE, 82%, ENSRNOG00000007067, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40%…
Product Name : TNFαTarget points: Zhejiang UniversityStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of…
Product Name : OCIA domain containing 2Target gene : OCIAD2verified_species_reactivity : Humaninterspecies_information : 79%, ENSMUSG00000029153, species_id: MOUSE, 79%, ENSRNOG00000002196, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : HER3Target points: University of Texas at AustinStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream.…
Product Name : negative regulator of ubiquitin-like proteins 1Target gene : NUB1verified_species_reactivity : Humaninterspecies_information : 84%, ENSMUSG00000028954, species_id: MOUSE, 86%, ENSRNOG00000009282, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer :…
Product Name : MFGE8Target points: ThrombogenicsStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two…
Product Name : nuclear receptor subfamily 0 group B member 1Target gene : NR0B1verified_species_reactivity : Humaninterspecies_information : 79%, ENSMUSG00000025056, species_id: MOUSE, 80%, ENSRNOG00000003765, species_id: RATclonality : Polyclonalisotype : IgGhost :…
Product Name : TSPAN33Target points: Eli LillyStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of…
Product Name : N-myristoyltransferase 1Target gene : NMT1verified_species_reactivity : Humaninterspecies_information : 91%, ENSMUSG00000020936, species_id: MOUSE, 91%, ENSRNOG00000002989, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and PBS…
Product Name : IL-1RAPTarget points: Bluefin BiomedicineStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of…
Product Name : NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDaTarget gene : NDUFB7verified_species_reactivity : Humaninterspecies_information : 84%, ENSMUSG00000033938, species_id: MOUSE, 79%, ENSRNOG00000028717, species_id: RATclonality : Polyclonalisotype : IgGhost :…
Product Name : HER2/neuTarget points: Redwood BiosciencesStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of…
Product Name : N-acetylneuraminic acid synthaseTarget gene : NANSverified_species_reactivity : Humaninterspecies_information : 86%, ENSMUSG00000028334, species_id: MOUSE, 88%, ENSRNOG00000008945, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and…
Product Name : CLDN1Target points: Osaka UniversityStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of…
Product Name : myosin light chain kinaseTarget gene : MYLKverified_species_reactivity : Humaninterspecies_information : 92%, ENSMUSG00000022836, species_id: MOUSE, 92%, ENSRNOG00000002215, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : EGFRHER2/neuTarget points: NovartisStatus: Organization : Short name : Type: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light…
Product Name : PD-1Target points: GeorgiamuneStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two…
KRAS mutations have wide-spread prevalence in human cancers nowadays. The mis-sense mutation of KRAS at codon 12 aberrantly activates the protein into a hyperexcitable state. Attenuating its GTPase activity results…
Product Name : UndisclosedTarget points: Hangzhou DAC BiotechStatus: Organization : Short name : Type: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of…
Cancer is most serious diseases as we often mentioned in our blog. It involves abnormal cell growth. These cells have the potential to invade or spread to other parts of…
Product Name : mPEG23-OCH2CH2COONHS EsterFull Name: mPEG23-OCH2CH2COONHS EsterSynonyms : m-PEG24-NHS EsterCAS:2395839-96-8Molecular formula : C54H103NO28Molecular Weight: 1214.84371-65-3 custom synthesis 39Appearance: White SolidStorage: -18℃ for long term storage, avoid light2869954-34-5 Description PMID:25905352…
Product Name : CKAP2Target points: Sungkyunkwan UniversityStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of…
Product Name : Maleimide-(CH2)5-COOHFull Name: 6-Maleimidohexanoic AcidSynonyms : Maleimide-(CH2)5-COOHCAS:55750-53-3Molecular formula : C10H13NO4Molecular Weight: 211.1898283-02-7 In stock 22Appearance: White PowderStorage: -18℃ for long term storage, avoid light1433953-83-3 manufacturer PMID:30725974 MedChemExpress (MCE)…
Product Name : OX40Target points: AmgenKyowa Hakko KirinStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist…
Product Name : ABCC5 Monoclonal Antibody (2H10F11), CoraLite® Plus 488Species Reactivity: Human, RatHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: 2H10F11Conjugate : CoraLite® Plus 488 View additional formats UnconjugatedForm: LiquidConcentration :…
Product Name : OX40Target points: IGM BiosciencesStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of…
Product Name : Rabbit anti-HDAC6 Polyclonal AntibodySynonym : CPBHM; HD6; JM21; PPP1R90Host : RabbitSpecies Reactivity: Human, Mouse, RatSpecificity : Predicted Reactivity: Applications : WB 1:500 – 1:2000Immunogen: Recombinant fusion protein…
Product Name : TMPRSS11ETarget points: ForerunnerStatus: TMPRSS11EOrganization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two…
Product Name : Rabbit anti-WNT2 Polyclonal AntibodySynonym : INT1L1; IRPHost : RabbitSpecies Reactivity: Human, RatSpecificity : Predicted Reactivity: Applications : WB 1:500 – 1:2000IHC 1:50 – 1:200Immunogen: Recombinant fusion protein…
Product Name : GPRC5DTarget points: Sloan Kettering InstituteStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist…
Product Name : Rabbit anti-RBCK1 Polyclonal Antibody(N-term)Synonym : RanBP-type and C3HC4-type zinc finger-containing protein 1; 632-; HBV-associated factor 4; Heme-oxidized IRP2 ubiquitin ligase 1; HOIL-1; Hepatitis B virus X-associated protein…
Product Name : HLA-ITarget points: Chugai PharmaceuticalStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of…
Product Name : ACSL4 Recombinant Rabbit Monoclonal Antibody (JE56-33)Species Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: JE56-33Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage…
Product Name : CD2Target points: BioTransplantMedimmuneStatus: CD2Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two…
Product Name : Rabbit anti-Integrin β3 Polyclonal AntibodySynonym : BDPLT16; BDPLT2; CD 61; CD61; CD61 antigen; GP3A; GPIIIa; GT; HPA 1; HPA 4; Integrin beta 3 (platelet glycoprotein IIIa antigen…
Product Name : CD3Target points: Arizona State UniversityStatus: CD3Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist…
Product Name : Rabbit anti-HMOX1 Polyclonal AntibodySynonym : bK286B10; HMOX1D; HO-1; HSP32Host : RabbitSpecies Reactivity: Human, Mouse, RatSpecificity : Predicted Reactivity: Applications : WB 1:500 – 1:2000IHC 1:50 – 1:200IF…
Product Name : TPBGCD3Target points: AmgenStatus: Organization : Short name : Type: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light…
Product Name : Rabbit anti-CLIC3 Polyclonal AntibodySynonym : Chloride intracellular channel protein 3Host : RabbitSpecies Reactivity: Human, Mouse, RatSpecificity : Recognizes endogenous levels of CLIC3 protein.Predicted Reactivity: Applications : WB…
Product Name : IgETarget points: BioXpressStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two…
Product Name : Rabbit anti-CHSY1 Polyclonal AntibodySynonym : CHSY; CSS1; KIAA0990; Chondroitin sulfate synthase 1; Chondroitin glucuronyltransferase 1; Chondroitin synthase 1; ChSy-1; Glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase 1; N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase 1; N-acetylgalactosaminyltransferase 1Host…
Product Name : IL3RTarget points: AffimedStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two…
Product Name : Rabbit anti-SASH1 Polyclonal AntibodySynonym : PEPE 1; PEPE1; Proline glutamate repeat containing protein; Proline-glutamate repeat-containing protein; RP3 323M4.1; SAM and SH3 domain containing 1; SAM and SH3…
Product Name : BCMASLAMF7Target points: Si’an Medical TechnologyStatus: Organization : Short name : Type: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of…
Product Name : Annexin V Polyclonal Antibody, CoraLite® Plus 647Species Reactivity: Human, Mouse, Pig, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : CoraLite® Plus 647Form: LiquidConcentration : Purification :…
Product Name : ZED-1227Description:ZED-1227 is a specific and orally active transglutaminase 2 (TG2) inhibitor, with an IC50 of 45 nM. ZED-1227 can block inflammation-induced TG2 expression and activity. ZED-1227 can…
Product Name : HS-PEG24-CH2COOHFull Name: PEG 2-mercaptoethyl ether acetic acid; HS-PEG24- CH2COOHSynonyms : PEG 2-mercaptoethyl ether acetic acidCAS:Molecular formula : C50H100O26SMolecular Weight: 1149.1610943-06-0 In stock 38Appearance: White Waxy SolidStorage: -18C…
Product Name : GenkwaninDescription:Genkwanin is a major non-glycosylated flavonoid with anti-flammatory activities.CAS: 437-64-9Molecular Weight:284.26Formula: C16H12O5Chemical Name: 5-hydroxy-2-(4-hydroxyphenyl)-7-methoxy-4H-chromen-4-oneSmiles : COC1=CC(O)=C2C(=C1)OC(=CC2=O)C1C=CC(O)=CC=1InChiKey: JPMYFOBNRRGFNO-UHFFFAOYSA-NInChi : InChI=1S/C16H12O5/c1-20-11-6-12(18)16-13(19)8-14(21-15(16)7-11)9-2-4-10(17)5-3-9/h2-8,17-18H,1H3Purity: ≥98% (or refer to the Certificate of Analysis)Shipping…
Product Name : Alkaline Phosphatase (Placental)/PLAP (Germ Cell Tumor Marker) Monoclonal Antibody (PL8-F6)Species Reactivity: HumanHost/Isotype : Mouse / IgG2b, kappaClass:MonoclonalType : AntibodyClone: PL8-F6Conjugate : UnconjugatedForm: LiquidConcentration : 200 µg/mLPurification :…
Product Name : TiaprostDescription:Tiaprost is a prostaglandin F2α (PGF2α) analogue.CAS: 71116-82-0Molecular Weight:396.50Formula: C20H28O6SChemical Name: (5E)-7-3,5-dihydroxy-2-cyclopentylhept-5-enoic acidSmiles : OC(=O)CCC/C=C/CC1C(/C=C/C(O)COC2=CSC=C2)C(O)CC1OInChiKey: FYBFDIIAPRHIQS-SYJKBYRUSA-NInChi : InChI=1S/C20H28O6S/c21-14(12-26-15-9-10-27-13-15)7-8-17-16(18(22)11-19(17)23)5-3-1-2-4-6-20(24)25/h1,3,7-10,13-14,16-19,21-23H,2,4-6,11-12H2,(H,24,25)/b3-1+,8-7+Purity: ≥98% (or refer to the Certificate of Analysis)Shipping Condition:…
Product Name : Adiponectin receptor Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.13 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS,…
Product Name : 6-Diazo-5-oxo-L-nor-LeucineDescription:L-6-Diazo-5-oxonorleucine (L-6-Diazo-5-oxonorleucine) is a glutaminases antagonist with a Ki of 6 μM. L-6-Diazo-5-oxonorleucine exhibits analgesic, antibacterial, antiviral and anticancer properties. L-6-Diazo-5-oxonorleucine displays genetic toxicity in vitro. L-6-Diazo-5-oxonorleucine…
Product Name : Acetyl-Histone H4 (Lys12) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS…
Product Name : Chembridge-5861528Description:Chembridge-5861528 is a TRPA1 channel blocker that antagonizes AITC- and 4-HNE-evoked calcium influx (IC50 values are 14.3 and 18.7μM respectively).CAS: 332117-28-9Molecular Weight:369.42Formula: C19H23N5O3Chemical Name: N-4-phenyl-2-(1,3-dimethyl-2,6-dioxo-2,3,6,7-tetrahydro-1H-purin-7-yl)acetamideSmiles : CC(C)C1C=CC(=CC=1)NC(=O)CN1C=NC2=C1C(=O)N(C)C(=O)N2CInChiKey:…
Product Name : ATR Recombinant Polyclonal Antibody (23HCLC)Species Reactivity: HumanHost/Isotype : Rabbit / IgGClass:Recombinant PolyclonalType : AntibodyClone: 23HCLCConjugate : UnconjugatedForm: LiquidConcentration : 0.5 mg/mLPurification : Protein AStorage buffer: PBS, pH…
Product Name : Dihydroergotamine mesylateDescription:Dihydroergotamine mesylate is an ergot alkaloid used to treat migraines.Target: 5-HT ReceptorsDihydroergotamine is not as effective as sumatriptan or phenothiazines as a single agent for treatment…
Product Name : ATP7B Monoclonal Antibody (3E10)Species Reactivity: HumanHost/Isotype : Mouse / IgG1, kappaClass:MonoclonalType : AntibodyClone: 3E10Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer: PBS, pH 7.4Contains :…
Product Name : Tibenelast sodiumDescription:Tibenelast sodium is a phosphodiesterase inhibitor.CAS: 105102-18-9Molecular Weight:288.29Formula: C13H13NaO4SChemical Name: sodium 5,6-diethoxy-1-benzothiophene-2-carboxylateSmiles : .CCOC1C=C2SC(=CC2=CC=1OCC)C()=OInChiKey: ILEWAUWOUIHKID-UHFFFAOYSA-MInChi : InChI=1S/C13H14O4S.Na/c1-3-16-9-5-8-6-12(13(14)15)18-11(8)7-10(9)17-4-2;/h5-7H,3-4H2,1-2H3,(H,14,15);/q;+1/p-1Purity: ≥98% (or refer to the Certificate of Analysis)Shipping Condition:…
Product Name : ATG7 Monoclonal Antibody (29CT10.3.12)Species Reactivity: HumanHost/Isotype : Mouse / IgG2b, kappaClass:MonoclonalType : AntibodyClone: 29CT10.3.12Conjugate : UnconjugatedForm: LiquidConcentration : Conc. not determinedPurification : Storage buffer: ascites, pH 7.4Contains…
Product Name : ZM241385Description:ZM241385 is a potent, high affinity and selective adenosine A2a receptor (A2AR) antagonist with a Ki value of 1.4 nM.CAS: 139180-30-6Molecular Weight:337.34Formula: C16H15N7O2Chemical Name: 4-(2-triazolotriazin-5-yl]aminoethyl)phenolSmiles : NC1=NC(NCCC2C=CC(O)=CC=2)=NC2=NC(=NN21)C1=CC=CO1InChiKey:…
Product Name : ATF4 Monoclonal Antibody (
Product Name : Tarloxotinib bromideDescription:Tarloxotinib bromide (TH-4000) is an irreversible EGFR/HER2 inhibitor.CAS: 1636180-98-7Molecular Weight:681.77Formula: C24H24Br2ClN9O3Chemical Name: pyridopyrimidin-6-ylcarbamoyl)prop-2-en-1-yl]dimethylazanium bromideSmiles : .CN1C=NC(=C1C(C)(C)C/C=C/C(=O)NC1=CC2C(NC3C=CC(Cl)=C(Br)C=3)=NC=NC=2C=N1)()=OInChiKey: WAKIMVYUBWMMHJ-FXRZFVDSSA-NInChi : InChI=1S/C24H23BrClN9O3.BrH/c1-33-14-30-24(34(37)38)20(33)12-35(2,3)8-4-5-22(36)32-21-10-16-19(11-27-21)28-13-29-23(16)31-15-6-7-18(26)17(25)9-15;/h4-7,9-11,13-14H,8,12H2,1-3H3,(H-,27,28,29,31,32,36);1H/b5-4+;Purity: ≥98% (or refer to the Certificate of…
Product Name : ASS1 Monoclonal Antibody (11F1)Species Reactivity: HumanHost/Isotype : Mouse / IgG2bClass:MonoclonalType : AntibodyClone: 11F1Conjugate : UnconjugatedForm: LiquidConcentration : 2 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH 7.4, with…
Product Name : ZoliflodacinDescription:Zoliflodacin (ETX0914;AZD0914) is a novel spiropyrimidinetrione bacterial DNA gyrase/topoisomerase inhibitor. Zoliflodacin has potent in vitro antibacterial activity against Gram-positive and Gram-negative organisms, including S. aureus with the…
Product Name : ARNTL Monoclonal Antibody (OTI1C11), TrueMAB™Species Reactivity: HumanHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: OTI1C11Conjugate : UnconjugatedForm: lyophilizedConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH 7.3,…
Product Name : Evans BlueDescription:Evans Blue is a potent inhibitor of L-glutamate uptake via the membrane bound excitatory amino acid transporter (EAAT). Able to antagonize AMPA and kainate receptor mediated…
Product Name : ARL6IP4 Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 2.67 mg/mLPurification : Affinity ChromatographyStorage buffer: PBS, pH 7.3,…
Product Name : AS2717638Description:AS2717638 is an oral active and selective lysophosphatidic acid receptor 5 (LPA5) antagonist, with an IC50 of 38 nM for hLPA5. AS2717638 also significantly improves PGE2-, PGF2α-,…
Product Name : ARHGDIA Monoclonal Antibody (OTI1A7), TrueMAB™Species Reactivity: HumanHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: OTI1A7Conjugate : UnconjugatedForm: lyophilizedConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH 7.3,…
Product Name : NoxA1ds TFADescription:NoxA1ds TFA is a potent and selective NADPH oxidase 1 (NOX1) inhibitor (IC50=20 nM). NoxA1ds TFA exhibits selectivity for NOX1 over NOX2, NOX4, NOX5 and xanthine…
Product Name : AQP0 Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LyophilizedConcentration : Conc. Not DeterminedPurification : Storage buffer: whole serumContains : no preservativeStorage…
Product Name : Angiotensinogen (1-14), human TFADescription:Angiotensinogen (1-14), human TFA is a fragment of the renin substrate angiotensinogen. Angiotensinogen is naturally occurring substrate for renin and a precursor for all…
Product Name : ANGPTL1 Monoclonal Antibody (3A5)Species Reactivity: HumanHost/Isotype : Mouse / IgG2a, kappaClass:MonoclonalType : AntibodyClone: 3A5Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer: PBS, pH 7.4Contains :…
Product Name : QX-314 chlorideDescription:QX-314 chloride is a membrane-impermeable permanently charged sodium channel blocker.CAS: 5369-03-9Molecular Weight:298.85Formula: C16H27ClN2OChemical Name: methyltriethylazanium chlorideSmiles : .CC1C=CC=C(C)C=1NC(=O)C(CC)(CC)CCInChiKey: LLPPOMUAOGMYQI-UHFFFAOYSA-NInChi : InChI=1S/C16H26N2O.ClH/c1-6-18(7-2,8-3)12-15(19)17-16-13(4)10-9-11-14(16)5;/h9-11H,6-8,12H2,1-5H3;1HPurity: ≥98% (or refer to the…
Product Name : AMPK beta-1 Polyclonal AntibodySpecies Reactivity: Human, Mouse, Non-human primate, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer:…
Product Name : CHIKV-IN-2Description:CHIKV-IN-2 is a potent inhibitor against Chikungunya virus (CHIKV), with excellent cellular antiviral activity (EC90=270 nM) and improved liver microsomal stability. CHIKV-IN-2 shows inhibitory activity against a…
Product Name : ALPK1 Monoclonal Antibody (2B8B5)Species Reactivity: Human, MouseHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: 2B8B5Conjugate : UnconjugatedForm: LiquidConcentration : 500 µg/mLPurification : Protein GStorage buffer: PBS, pH 7.3,…
Product Name : 1-Methyl-2-undecyl-4(1H)-quinoloneDescription:1-Methyl-2-undecyl-4(1H)-quinolone is a potent, irreversible and selective inhibitor of type B monoamine oxidase (MAO-B). 1-Methyl-2-undecyl-4(1H)-quinolone shows a selective inhibition of MAO-B activity with the IC50 and Ki…
Product Name : ALDH1A3 Monoclonal Antibody (OTI4B6)Species Reactivity: Dog, Human, Non-human primateHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: OTI4B6Conjugate : UnconjugatedForm: LiquidConcentration : 1.0 mg/mLPurification : Affinity ChromatographyStorage buffer: PBS,…
Product Name : Carboxyamidotriazole OrotateDescription:Carboxyamidotriazole Orotate (L-651582 Orotate) is the orotate salt form of Carboxyamidotriazole (CAI), an orally bioavailable signal transduction inhibitor. Carboxyamidotriazole Orotate is a cytostatic inhibitor of nonvoltage-operated…
Product Name : ALDH18A1 Monoclonal Antibody (2B5)Species Reactivity: HumanHost/Isotype : Mouse / IgG2b, kappaClass:MonoclonalType : AntibodyClone: 2B5Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer: PBS, pH 7.4Contains :…
Product Name : Butyrolactone 3Description:Butyrolactone 3 is a specifical small-molecule inhibitor of the histone acetyltransferase Gcn5 (IC50=100 μM), which has a high affinity to the Gcn5 enzyme comparable to that…
Product Name : AKR1C1 Polyclonal AntibodySpecies Reactivity: Human, Non-human primateHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS with 50%…
Product Name : Diethyl succinateDescription:Diethyl succinate (Diethyl Butanedioate) is used at physiological pH and crosses biological membranes, incorporates into cells in tissue culture and is metabolized by the TCA cycle.…
Product Name : AIF Recombinant Rabbit Monoclonal Antibody (SZ05-01)Species Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: SZ05-01Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage…
Product Name : Cetrorelix AcetateDescription:Cetrorelix Acetate (SB-75 acetate) is a potent gonadotropin-releasing hormone (GnRH) receptor antagonist with an IC50 of 1.21 nM.CAS: 145672-81-7Molecular Weight:1491.09Formula: C72H96ClN17O16Chemical Name: (2S)-N-carbamoylpyrrolidin-1-yl]-1-oxopentan-2-yl]-2-propanamido]-3-(pyridin-3-yl)propanamido]-3-hydroxypropanamido]-3-(4-hydroxyphenyl)propanamido]pentanamido]-4-methylpentanamide; acetic acidSmiles :…
Product Name : 4 HNE Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Goat / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Antigen affinity chromatographyStorage buffer: 75mM sodium phosphate,…
Product Name : Propargyl-PEG3-alcoholDescription:Propargyl-PEG3-alcohol is a PEG-based PROTAC linker can be used in the synthesis of PROTACs.CAS: 208827-90-1Molecular Weight:188.22Formula: C9H16O4Chemical Name: 2-2-ethoxyethan-1-olSmiles : C#CCOCCOCCOCCOInChiKey: CXJWUJYYDLYCCQ-UHFFFAOYSA-NInChi : InChI=1S/C9H16O4/c1-2-4-11-6-8-13-9-7-12-5-3-10/h1,10H,3-9H2Purity: ≥98% (or refer…
Product Name : Ethyl phenylacetateDescription:Ethyl phenylacetate is a natural flavouring ingredien, and its sensory threshold is near 73 µg/L. Ethyl phenylacetate is a “greener” solvent with low toxicity. Ethyl phenylacetate…
Product Name : AmicarbazoneDescription:Amicarbazone is a bio-active chemical.CAS: 129909-90-6Molecular Weight:241.29Formula: C10H19N5O2Chemical Name: 4-amino-N-tert-butyl-5-oxo-3-(propan-2-yl)-4,5-dihydro-1H-1,2,4-triazole-1-carboxamideSmiles : CC(C)C1=NN(C(=O)N1N)C(=O)NC(C)(C)CInChiKey: ORFPWVRKFLOQHK-UHFFFAOYSA-NInChi : InChI=1S/C10H19N5O2/c1-6(2)7-13-15(9(17)14(7)11)8(16)12-10(3,4)5/h6H,11H2,1-5H3,(H,12,16)Purity: ≥98% (or refer to the Certificate of Analysis)Shipping Condition: Shipped under ambient…
Product Name : Amitriptyline HydrochlorideDescription:Amitriptyline, sold under the brand name Elavil among others, is a medication used to treat a number of mental illnesses. This including major depressive disorder and…
Product Name : Alkyne-PEG4-NHSTag: CAS : 1428629-70-2Chemical Formula:C16H23NO8Molecular Weight : 357.36Physical Form: colorless oilSolubility : DCM, THF, acetonitrile, DMF and DMSOStorage at: Additional information : Specifications:|Chemical Formula: C16H23NO8|Molecular Weight: 357.69075-42-9…
Product Name : PFK-015Description:PFK-015 is a potent inhibitor of PFKFB3. The preliminary results in a U87GM xenograft model have shown that PFK-015 has comparable activity to Temozolomide. PFK-015 inhibits glucoseuptake…
Product Name : VAS-2870Sequence: Purity: ≥98% (HPLC)Molecular Weight:360.4Solubility : Soluble in DMSO (up to 10mg/ml) or DMF (up to 25mg/ml).Appearance: White to off-white solid.Use/Stability : As indicated on product label…
Product Name : Daun02Description:Daun02 is a Cell viability inhibitor and DNA synthisis inhibitor with IC50 values of 1.5 μM, 3.5 μM and 0.5 μM, respectively. Daun02 is also a anthracycline…
Product Name : Thrombomodulin monoclonal antibody (Phx-01)Sequence: Purity: Molecular Weight:Solubility : Appearance: Use/Stability : Description: CAS : Solubility: Formula: Additional Information : | Alternative Name CD141, Fetomodulin | Application ELISA,…
Product Name : Amifostine thiolDescription:Amifostine thiol (WR-1065) is an active metabolite of the cytoprotector Amifostine (HY-B0639). Amifostine thiol is a cytoprotective agent with radioprotective abilities. Amifostine thiol activates p53 through…
Product Name : Suc-Leu-Tyr-AMCSequence: Suc-Leu-Tyr-AMC (AMC=7-Amino-4-methylcoumarin)Purity: ≥95%Molecular Weight:551.6Solubility : Soluble in 80% acetic acid, DMSO or methanol.Appearance: White to off-white powder.Use/Stability : As indicated on product label or CoA when…
Product Name : β-Elemonic acidDescription:β-Elemonic acid is a triterpene isolated from Boswellia papyrifera. β-Elemonic acid induces cell apoptosis, reactive oxygen species (ROS) and COX-2 expression and inhibits prolyl endopeptidase. β-Elemonic…
Product Name : RotenoneSequence: Purity: ≥97% (UHPLC)Molecular Weight:394.4Solubility : Soluble in DMSO or 100% ethanol; slightly soluble in water.Appearance: White to off-white solid.Use/Stability : As indicated on product label or…
Product Name : IgG4SP/Kappa Isotype Controlsynonym : productDescription : NonemolecularWeight : 145.2 kDaendotoxin : ＜1.0 EU per mgpurity : >95% as determined by SDS-PAGE.formulation : 100mM Pro 20mM Arg pH5.0storage…
Product Name : IgG1/Kappa Isotype Controlsynonym : productDescription : NonemolecularWeight : 150 kDaendotoxin : ＜1.0 EU per mgpurity : >95% as determined by SDS-PAGE.formulation : 100mM Pro 20mM Arg pH5.0storage…
Product Name : Anti-LIV-1 / SLC39A6 Reference Antibody (ladiratuzumab)synonym : null,productDescription : Anti-LIV-1 / SLC39A6 Reference Antibody (ladiratuzumab)(CHA999) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : IgG1 / Kappa Isotype Control（MMAE）synonym : productDescription : NonemolecularWeight : 153.346 kDaendotoxin :
Product Name : Anti-B7-H1 / PD-L1 / CD274 Reference Antibody (opucolimab)synonym : null,productDescription : Anti-B7-H1 / PD-L1 / CD274 Reference Antibody (opucolimab)(CHA997) is expressed from CHO. The heavy chain type…
Product Name : Anti-LAG3 / CD223 Reference Antibody (miptenalimab)synonym : null,productDescription : Anti-LAG3 / CD223 Reference Antibody (miptenalimab)(CHA996) is expressed from CHO. The heavy chain type is huIgG4SP, and the…
Product Name : Anti-LAG3 / CD223 Reference Antibody (ieramilimab)synonym : null,productDescription : Anti-LAG3 / CD223 Reference Antibody (ieramilimab)(CHA995) is expressed from CHO. The heavy chain type is huIgG4SP, and the…
Product Name : Anti-LAG3 / CD223 Reference Antibody (fianlimab)synonym : null,productDescription : Anti-LAG3 / CD223 Reference Antibody (fianlimab)(CHA994) is expressed from CHO. The heavy chain type is huIgG4SP, and the…
Product Name : Anti-LAG3 / CD223 Reference Antibody (favezelimab)synonym : null,productDescription : Anti-LAG3 / CD223 Reference Antibody (favezelimab)(CHA993) is expressed from CHO. The heavy chain type is huIgG4SP, and the…
Product Name : Anti-GLUT-1 Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 54endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-EpCAM / TROP1 / CD326 Reference Antibody (oportuzumab)synonym : null,productDescription : Anti-EpCAM / TROP1 / CD326 Reference Antibody (oportuzumab)(CHA991) is expressed from CHO. The heavy chain type…
Product Name : Anti-LAG3 / CD223 Reference Antibody (encelimab)synonym : null,productDescription : Anti-LAG3 / CD223 Reference Antibody (encelimab)(CHA992) is expressed from CHO. The heavy chain type is huIgG4SP, and the…
Product Name : Anti-Integrin aVb3 (ITGAV & ITGB3) Reference Antibody (etaracizumab)synonym : null,productDescription : Anti-Integrin aVb3 (ITGAV & ITGB3) Reference Antibody (etaracizumab)(CHA989) is expressed from CHO. The heavy chain type…
Product Name : Anti-LINGO1 Reference Antibody (opicinumab)synonym : null,productDescription : Anti-LINGO1 Reference Antibody (opicinumab)(CHA990) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-Integrin aV / ITGAV / CD51 Reference Antibody (intetumumab)synonym : null,productDescription : Anti-Integrin aV / ITGAV / CD51 Reference Antibody (intetumumab)(CHA988) is expressed from CHO. The heavy…
Product Name : Anti-Integrin aV / ITGAV / CD51 Reference Antibody (abituzumab)synonym : null,productDescription : Anti-Integrin aV / ITGAV / CD51 Reference Antibody (abituzumab)(CHA987) is expressed from CHO. The heavy…
Product Name : Anti-Integrin aL / ITGAL / CD11a Reference Antibody (efalizumab)synonym : null,productDescription : Anti-Integrin aL / ITGAL / CD11a Reference Antibody (efalizumab)(CHA986) is expressed from CHO. The heavy…
Product Name : Anti-Integrin a5b1 (ITGA5 & ITGB1) Reference Antibody (BMS patent anti-Integrin α5β1)synonym : null,productDescription : Anti-Integrin a5b1 (ITGA5 & ITGB1) Reference Antibody (BMS patent anti-Integrin α5β1)(CHA984) is expressed…
Product Name : Anti-Integrin a2b1 (ITGA2 & ITGB1) Reference Antibody (vatelizumab)synonym : null,productDescription : Anti-Integrin a2b1 (ITGA2 & ITGB1) Reference Antibody (vatelizumab)(CHA982) is expressed from CHO. The heavy chain type…
Product Name : Anti-PCSK9 Reference Antibody (ongericimab)synonym : null,productDescription : Anti-PCSK9 Reference Antibody (ongericimab)(CHA981) is expressed from CHO. The heavy chain type is huIgG4SP, and the light chain type is…
Product Name : Anti-Glucagon Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 21endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-IL-7Ra / CD127 Reference Antibody (PF-06342674)synonym : null,productDescription : Anti-IL-7Ra / CD127 Reference Antibody (PF-06342674)(CHA979) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-B7-H3 / CD276 Reference Antibody (omburtamab)synonym : null,productDescription : Anti-B7-H3 / CD276 Reference Antibody (omburtamab)(CHA978) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-IgE Reference Antibody (omalizumab)synonym : null,productDescription : Anti-IgE Reference Antibody (omalizumab)(CHA977) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-IL-6 / IFNb2 Reference Antibody (olokizumab)synonym : null,productDescription : Anti-IL-6 / IFNb2 Reference Antibody (olokizumab)(CHA976) is expressed from CHO. The heavy chain type is huIgG4SP, and the…
Product Name : Anti-IL-6Ra / CD126 Reference Antibody (sapelizumab)synonym : null,productDescription : Anti-IL-6Ra / CD126 Reference Antibody (sapelizumab)(CHA974) is expressed from CHO. The heavy chain type is huIgG2, and the…
Product Name : Anti-IL-6Ra / CD126 Reference Antibody (levilimab)synonym : null,productDescription : Anti-IL-6Ra / CD126 Reference Antibody (levilimab)(CHA973) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-IL-6Ra / CD126 Reference Antibody (APX007)synonym : null,productDescription : Anti-IL-6Ra / CD126 Reference Antibody (APX007)(CHA972) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-IL-6 / IFNb2 Reference Antibody (ziltivekimab)synonym : null,productDescription : Anti-IL-6 / IFNb2 Reference Antibody (ziltivekimab)(CHA971) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-IL-6 / IFNb2 Reference Antibody (sirukumab)synonym : null,productDescription : Anti-IL-6 / IFNb2 Reference Antibody (sirukumab)(CHA970) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-IL-6 / IFNb2 Reference Antibody (siltuximab)synonym : null,productDescription : Anti-IL-6 / IFNb2 Reference Antibody (siltuximab)(CHA969) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-GFAP Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 50endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-VEGFR2 / KDR / CD309 Reference Antibody (olinvacimab)synonym : null,productDescription : Anti-VEGFR2 / KDR / CD309 Reference Antibody (olinvacimab)(CHA968) is expressed from CHO. The heavy chain type…
Product Name : Anti-IL-6 / IFNb2 Reference Antibody (Merck patent anti-IL-6)synonym : null,productDescription : Anti-IL-6 / IFNb2 Reference Antibody (Merck patent anti-IL-6)(CHA967) is expressed from CHO. The heavy chain type…
Product Name : Anti-IL-6 / IFNb2 Reference Antibody (MEDI 5117)synonym : null,productDescription : Anti-IL-6 / IFNb2 Reference Antibody (MEDI 5117)(CHA966) is expressed from CHO. The heavy chain type is huIgG1,…
Product Name : Anti-IL-6 / IFNb2 Reference Antibody (Medarex patent anti-IL-6)synonym : null,productDescription : Anti-IL-6 / IFNb2 Reference Antibody (Medarex patent anti-IL-6)(CHA965) is expressed from CHO. The heavy chain type…
Product Name : Anti-IL-6 / IFNb2 Reference Antibody (CSTRI patent anti-IL-6)synonym : null,productDescription : Anti-IL-6 / IFNb2 Reference Antibody (CSTRI patent anti-IL-6)(CHA963) is expressed from CHO. The heavy chain type…
Product Name : Anti-IL-6 / IFNb2 Reference Antibody (Chugai SK2)synonym : null,productDescription : Anti-IL-6 / IFNb2 Reference Antibody (Chugai SK2)(CHA962) is expressed from CHO. The heavy chain type is huIgG1,…
Product Name : Anti-IL-5 Reference Antibody (Abgenix anti-IL-5)synonym : null,productDescription : Anti-IL-5 Reference Antibody (Abgenix anti-IL-5)(CHA960) is expressed from CHO. The heavy chain type is huIgG4, and the light chain…
Product Name : Anti-oxLDL Reference Antibody (Okayama U. patent anti-oxLDL)synonym : null,productDescription : Anti-oxLDL Reference Antibody (Okayama U. patent anti-oxLDL)(CHA961) is expressed from CHO. The heavy chain type is huIgG1,…
Product Name : Anti-CD20 / MS4A1 Reference Antibody (ofatumumab)synonym : null,productDescription : Anti-CD20 Reference Antibody (ofatumumab)(CHA957) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-IL-4Ra / CD124 Reference Antibody (MEDI2045)synonym : null,productDescription : Anti-IL-4Ra / CD124 Reference Antibody (MEDI2045)(CHA959) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-GCDFP-15 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 17endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-Annexin A1 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 39 kDaendotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : Humanconcentration :…
Product Name : Anti-IL-33 Reference Antibody (itepekimab)synonym : null,productDescription : Anti-IL-33 Reference Antibody (itepekimab)(CHA954) is expressed from CHO. The heavy chain type is huIgG4SP, and the light chain type is…
Product Name : Anti-CD20 / MS4A1 Reference Antibody (ocrelizumab)synonym : null,productDescription : Anti-CD20 Reference Antibody (ocrelizumab)(CHA953) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-TIGIT Reference Antibody (ociperlimab)synonym : null,productDescription : Anti-TIGIT Reference Antibody (ociperlimab)(CHA952) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-CD20 / MS4A1 Reference Antibody (ocaratuzumab)synonym : null,productDescription : Anti-CD20 Reference Antibody (ocaratuzumab)(CHA951) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-IL-23a Reference Antibody (risankizumab)synonym : null,productDescription : Anti-IL-23a Reference Antibody (risankizumab)(CHA947) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-IL-2Ra / CD25 Reference Antibody (camidanlumAb)synonym : null,productDescription : Anti-IL-2Ra / CD25 Reference Antibody (camidanlumAb)(CHA950) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-IL-23 Reference Antibody (mirikizumab)synonym : null,productDescription : Anti-IL-23 Reference Antibody (mirikizumab)(CHA945) is expressed from CHO. The heavy chain type is huIgG4SP, and the light chain type is…
Product Name : Anti-IL-23 Reference Antibody (LY2525623)synonym : null,productDescription : Anti-IL-23 Reference Antibody (LY2525623)(CHA944) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-IL-23 Reference Antibody (brazikumab)synonym : null,productDescription : Anti-IL-23 Reference Antibody (brazikumab)(CHA942) is expressed from CHO. The heavy chain type is huIgG2, and the light chain type is…
Product Name : Anti-IL-21 Reference Antibody (avizakimab)synonym : null,productDescription : Anti-IL-21 Reference Antibody (avizakimab)(CHA941) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-GATA3 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 48endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-IL-20 Reference Antibody (Cheng Kung U. patent anti-IL-20)synonym : null,productDescription : Anti-IL-20 Reference Antibody (Cheng Kung U. patent anti-IL-20)(CHA940) is expressed from CHO. The heavy chain type…
Product Name : Anti-IL-1RL1 / ST2 / IL-33R Reference Antibody (melrilimab)synonym : null,productDescription : Anti-IL-1RL1 / ST2 / IL-33R Reference Antibody (melrilimab)(CHA939) is expressed from CHO. The heavy chain type…
Product Name : Anti-F8 / Factor VIII Reference Antibody (Novo Nordisk patent anti-Factor VIII)synonym : null,productDescription : Anti-F8 / Factor VIII Reference Antibody (Novo Nordisk patent anti-Factor VIII)(CHA938) is expressed…
Product Name : Anti-IL-1b Reference Antibody (CDP484)synonym : null,productDescription : Anti-IL-1b Reference Antibody (CDP484)(CHA937) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-IL-1a Reference Antibody (bermekimab)synonym : null,productDescription : Anti-IL-1a Reference Antibody (bermekimab)(CHA936) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-IL-18 Reference Antibody (ABT-325)synonym : null,productDescription : Anti-IL-18 Reference Antibody (ABT-325)(CHA933) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-IL-15 Reference Antibody (DISC0280)synonym : null,productDescription : Anti-IL-15 Reference Antibody (DISC0280)(CHA930) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-PTPRC / CD45 Reference Antibody (Novartis patent anti-CD45)synonym : null,productDescription : Anti-PTPRC / CD45 Reference Antibody (Novartis patent anti-CD45)(CHA929) is expressed from CHO. The heavy chain type…
Product Name : Anti-PDCD1 / PD-1 / CD279 Reference Antibody (nofazinlimab)synonym : productDescription : Anti-PDCD1 / PD-1 / CD279 Reference Antibody (nofazinlimab)(CHA928) is expressed from CHO. The heavy chain type…
Product Name : Anti-IL-13 Reference Antibody (M1295)synonym : null,productDescription : Anti-IL-13 Reference Antibody (M1295)(CHA927) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-Galectin-3 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 26endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-IL-13 Reference Antibody (lebrikizumab)synonym : null,productDescription : Anti-IL-13 Reference Antibody (lebrikizumab)(CHA926) is expressed from CHO. The heavy chain type is huIgG4SP, and the light chain type is…
Product Name : Anti-IL-13 Reference Antibody (IMA-026)synonym : null,productDescription : Anti-IL-13 Reference Antibody (IMA-026)(CHA925) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-IL-13 Reference Antibody (H2L6)synonym : null,productDescription : Anti-IL-13 Reference Antibody (H2L6)(CHA924) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-IL-13 Reference Antibody (GSK 679586)synonym : null,productDescription : Anti-IL-13 Reference Antibody (GSK 679586)(CHA923) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-IL-13 Reference Antibody (dectrekumab)synonym : null,productDescription : Anti-IL-13 Reference Antibody (dectrekumab)(CHA922) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-IL-13 Reference Antibody (cendakimab)synonym : null,productDescription : Anti-IL-13 Reference Antibody (cendakimab)(CHA921) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-IL-13 Reference Antibody (abrezekimab)synonym : null,productDescription : Anti-IL-13 Reference Antibody (abrezekimab)(CHA919) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-FcRn (FCGRT & B2M) Reference Antibody (nipocalimab)synonym : null,productDescription : Anti-FcRn (FCGRT & B2M) Reference Antibody (nipocalimab)(CHA917) is expressed from CHO. The heavy chain type is huIgG1,…
Product Name : Anti-IL-12 (IL-12a & IL-12b) Reference Antibody (briakinumab)synonym : null,productDescription : Anti-IL-12 (IL-12a & IL-12b) Reference Antibody (briakinumab)(CHA916) is expressed from CHO. The heavy chain type is huIgG1,…
Product Name : Anti-IL-10 Reference Antibody (BT-063)synonym : null,productDescription : Anti-IL-10 Reference Antibody (BT-063)(CHA915) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-FSH Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 78endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-IGF-2 Reference Antibody (DX-2647)synonym : null,productDescription : Anti-IGF2 Reference Antibody (DX-2647)(CHA914) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-ERBB1 / EGFR / HER1 Reference Antibody (nimotuzumab)synonym : null,productDescription : Anti-ERBB1 / EGFR / HER1 Reference Antibody (nimotuzumab)(CHA912) is expressed from CHO. The heavy chain type…
Product Name : Anti-Mesothelin Reference Antibody (NIH patent anti-Mesothelin)synonym : null,productDescription : Anti-Mesothelin Reference Antibody (NIH patent anti-Mesothelin)(CHA911) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-IGF1R / CD221 Reference Antibody (ganitumab)synonym : null,productDescription : Anti-IGF1R / CD221 Reference Antibody (ganitumab)(CHA910) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-IGF1R / CD221 Reference Antibody (figitumumab)synonym : null,productDescription : Anti-IGF1R / CD221 Reference Antibody (figitumumab)(CHA909) is expressed from CHO. The heavy chain type is huIgG2, and the…
Product Name : Anti-TPBG Reference Antibody (naptumomAb)synonym : null,productDescription : Anti-TPBG Reference Antibody (naptumomAb)(CHA908) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-IgE Reference Antibody (talizumab)synonym : null,productDescription : Anti-IgE Reference Antibody (talizumab)(CHA904) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-NT5E / CD73 Reference Antibody (mupadolimab)synonym : null,productDescription : Anti-NT5E / CD73 Reference Antibody (mupadolimab)(CHA903) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-IgE Reference Antibody (ligelizumab)synonym : null,productDescription : Anti-IgE Reference Antibody (ligelizumab)(CHA902) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-IgE (M1 prime) Reference Antibody (quilizumab)synonym : null,productDescription : Anti-IgE (M1 prime) Reference Antibody (quilizumab)(CHA901) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-FOXP1 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 75endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-IFNg Reference Antibody (emapalumab)synonym : null,productDescription : Anti-IFNg Reference Antibody (emapalumab)(CHA900) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-IFNg Reference Antibody (AMG 811)synonym : null,productDescription : Anti-IFNg Reference Antibody (AMG 811)(CHA899) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-ICOS / CD278 Reference Antibody (MEDI-570)synonym : null,productDescription : Anti-ICOS / CD278 Reference Antibody (MEDI-570)(CHA893) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-ICAM1 / CD54 Reference Antibody (bersanlimab)synonym : null,productDescription : Anti-ICAM1 / CD54 Reference Antibody (bersanlimab)(CHA890) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-ERBB1 / EGFR / HER1 Reference Antibody (modotuximab)synonym : null,productDescription : Anti-ERBB1 / EGFR / HER1 Reference Antibody (modotuximab)(CHA888) is expressed from CHO. The heavy chain type…
Product Name : Anti-B7-H3 / CD276 Reference Antibody (mirzotamab)synonym : null,productDescription : Anti-B7-H3 / CD276 Reference Antibody (mirzotamab)(CHA887) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-HGFR / c-Met Reference Antibody (SAIT301)synonym : null,productDescription : Anti-HGFR / c-Met Reference Antibody (SAIT301)(CHA884) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-Amyloid Beta Reference Antibody (Merck anti-Amyloid beta 19.3)synonym : null,productDescription : Anti-Amyloid Beta Reference Antibody (Merck anti-Amyloid beta 19.3)(CHA885) is expressed from CHO. The heavy chain type…
Product Name : Anti-HGFR / c-Met Reference Antibody (Metheresis patent anti-Met)synonym : null,productDescription : Anti-HGFR / c-Met Reference Antibody (Metheresis patent anti-Met)(CHA883) is expressed from CHO. The heavy chain type…
Product Name : Anti-HGF / SF Reference Antibody (TAK-701)synonym : null,productDescription : Anti-HGF / SF Reference Antibody (TAK-701)(CHA881) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-KID3 Reference Antibody (Macrogenics patent anti-KID3)synonym : null,productDescription : Anti-KID3 Reference Antibody (Macrogenics patent anti-KID3)(CHA879) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-FLI-1 Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 51endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-Hepcidin / HAMP Reference Antibody (Ludwig-Maximilians U. anti_Hepsin)synonym : null,productDescription : Anti-Hepcidin / HAMP Reference Antibody (Ludwig-Maximilians U. anti_Hepsin)(CHA877) is expressed from CHO. The heavy chain type…
Product Name : Anti-Hepcidin / HAMP Reference Antibody (LY2787106)synonym : null,productDescription : Anti-Hepcidin / HAMP Reference Antibody (LY2787106)(CHA878) is expressed from CHO. The heavy chain type is huIgG4SP, and the…
Product Name : Anti-ERBB1 / EGFR / HER1 Reference Antibody (losatuxizumAb)synonym : null,productDescription : Anti-ERBB1 / EGFR / HER1 Reference Antibody (losatuxizumAb)(CHA876) is expressed from CHO. The heavy chain type…
Product Name : Anti-IGF1R / CD221 Reference Antibody (lonigutamab)synonym : null,productDescription : Anti-IGF1R / CD221 Reference Antibody (lonigutamAb)(CHA874) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-GPR64 / ADGRG2 Reference Antibody (Facet patent anti-GPR64)synonym : null,productDescription : Anti-GPR64 / ADGRG2 Reference Antibody (Facet patent anti-GPR64)(CHA873) is expressed from CHO. The heavy chain type…
Product Name : Anti-CD19 Reference Antibody (Loncastuximab)synonym : null,productDescription : Anti-CD19 Reference Antibody (Loncastuximab)(CHA872) is expressed from CHO. The heavy chain type is huIgG1-EM-noK, and the light chain type is…
Product Name : Anti-PCSK9 Reference Antibody (lodelcizumab)synonym : null,productDescription : Anti-PCSK9 Reference Antibody (lodelcizumab)(CHA871) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-B7-H1 / PD-L1 / CD274 Reference Antibody (lodapolimab)synonym : null,productDescription : Anti-B7-H1 / PD-L1 / CD274 Reference Antibody (lodapolimab)(CHA870) is expressed from CHO. The heavy chain type…
Product Name : Anti-TSPAN26 / CD37 Reference Antibody (lilotomab)synonym : null,productDescription : Anti-TSPAN26 / CD37 Reference Antibody (lilotomab)(CHA869) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-Fascin Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 55endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-CD47 Reference Antibody (lemzoparlimab)synonym : null,productDescription : Anti-CD47 Reference Antibody (lemzoparlimab)(CHA867) is expressed from CHO. The heavy chain type is huIgG4SP, and the light chain type is…
Product Name : Anti-Sortilin / SORT1 Reference Antibody (latozinemab)synonym : null,productDescription : Anti-Sortilin / SORT1 Reference Antibody (latozinemab)(CHA866) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-HGFR / c-Met Reference Antibody (Korea RIBB patent anti-cMet)synonym : null,productDescription : Anti-HGFR / c-Met Reference Antibody (Korea RIBB patent anti-cMet)(CHA864) is expressed from CHO. The heavy…
Product Name : Anti-Amyloid Beta Reference Antibody (Kumamoto U. patent anti-Amyloid Beta)synonym : null,productDescription : Anti-Amyloid Beta Reference Antibody (Kumamoto U. patent anti-Amyloid Beta)(CHA865) is expressed from CHO. The heavy…
Product Name : Anti-TNFRSF18 / GITR / CD357 Reference Antibody (Korea Natl.Cancer Ctr. patent anti-GITR)synonym : null,productDescription : Anti-TNFRSF18 / GITR / CD357 Reference Antibody (Korea Natl.Cancer Ctr. patent anti-GITR)(CHA863)…
Product Name : Anti-GD2 Reference Antibody (EMD 273063)synonym : null,productDescription : Anti-GD2 Reference Antibody (EMD 273063)(CHA861) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-GD2 Reference Antibody (dinutuximab)synonym : null,productDescription : Anti-GD2 Reference Antibody (dinutuximab)(CHA860) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-ERG Reference Antibody (Jackson Foundation patent anti-ERG)synonym : null,productDescription : Anti-ERG Reference Antibody (Jackson Foundation patent anti-ERG)(CHA858) is expressed from CHO. The heavy chain type is huIgG1,…
Product Name : Anti-TNFRSF4 / OX40 / CD134 Reference Antibody (ivuxolimab)synonym : null,productDescription : Anti-TNFRSF4 / OX40 / CD134 Reference Antibody (ivuxolimab)(CHA857) is expressed from CHO. The heavy chain type…
Product Name : Anti-FZD Reference Antibody (vantictumab)synonym : null,productDescription : Anti-FZD Reference Antibody (vantictumab)(CHA855) is expressed from CHO. The heavy chain type is huIgG2, and the light chain type is…
Product Name : Anti-ESA Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 47endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-PDCD1 / PD-1 / CD279 Reference Antibody (iparomlimab)synonym : null,productDescription : Anti-PDCD1 / PD-1 / CD279 Reference Antibody (iparomlimab)(CHA854) is expressed from CHO. The heavy chain type…
Product Name : Anti-FOLH1 / PSMA Reference Antibody (pelgifatamAb)synonym : null,productDescription : Anti-FOLH1 / PSMA Reference Antibody (pelgifatamAb)(CHA853) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-Fibronectin Reference Antibody (radretumab)synonym : null,productDescription : Anti-Fibronectin Reference Antibody (radretumab)(CHA852) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-TSPAN8 Reference Antibody (INSERM patent anti-CO-029)synonym : null,productDescription : Anti-TSPAN8 Reference Antibody (INSERM patent anti-CO-029)(CHA851) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-FGFR1 / CD331 Reference Antibody (Lilly patent anti-FGFR-1)synonym : null,productDescription : Anti-FGFR1 / CD331 Reference Antibody (Lilly patent anti-FGFR-1)(CHA850) is expressed from CHO. The heavy chain type…
Product Name : Anti-DDR1 / CD167a Reference Antibody (Imperial College anti-DDR1)synonym : null,productDescription : Anti-DDR1 / CD167a Reference Antibody (Imperial College anti-DDR1)(CHA848) is expressed from CHO. The heavy chain type…
Product Name : Anti-IGF1R / CD221 Reference Antibody (Immunomedics patent anti-IGF-1R)synonym : null,productDescription : Anti-IGF1R / CD221 Reference Antibody (Immunomedics patent anti-IGF-1R)(CHA847) is expressed from CHO. The heavy chain type…
Product Name : Anti- FcRH5 / IRTA2 / CD307e Reference Antibody (DFRF4539A)synonym : productDescription : Anti- FcRL5 / IRTA2 / CD307e Reference Antibody (DFRF4539A)(CHA846) is expressed from CHO. The heavy…
Product Name : Anti-FceR2 / CD23 Reference Antibody (lumiliximab)synonym : null,productDescription : Anti-FceR2 / CD23 Reference Antibody (lumiliximab)(CHA845) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-F11 / Factor XI Reference Antibody (abelacimab)synonym : null,productDescription : Anti-F11 / Factor XI Reference Antibody (abelacimab)(CHA843) is expressed from CHO. The heavy chain type is huIgG1,…
Product Name : Anti-ERG Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 54endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-VEGFR2 / KDR / CD309 Reference Antibody (Imclone 6.64)synonym : null,productDescription : Anti-VEGFR2 / KDR / CD309 Reference Antibody (Imclone 6.64)(CHA840) is expressed from CHO. The heavy…
Product Name : Anti-CD19 Reference Antibody (Immunomedics hA19)synonym : null,productDescription : Anti-CD19 Reference Antibody (Immunomedics hA19)(CHA841) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-ERBB3 / HER3 Reference Antibody (barecetamab)synonym : null,productDescription : Anti-ERBB3 / HER3 Reference Antibody (barecetamab)(CHA838) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-ERBB3 / HER3 Reference Antibody (lumretuzumab)synonym : null,productDescription : Anti-ERBB3 / HER3 Reference Antibody (lumretuzumab)(CHA839) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-ERBB2 / HER2 / CD340 Reference Antibody (timigutuzumab)synonym : null,productDescription : Anti-ERBB2 / HER2 / CD340 Reference Antibody (timigutuzumab)(CHA837) is expressed from CHO. The heavy chain type…
Product Name : Anti-ERBB2 / HER2 / CD340 Reference Antibody (margetuximab)synonym : null,productDescription : Anti-ERBB2 / HER2 / CD340 Reference Antibody (margetuximab)(CHA835) is expressed from CHO. The heavy chain type…
Product Name : Anti-ERBB2 / HER2 / CD340 Reference Antibody (Hersintuzumab)synonym : null,productDescription : Anti-ERBB2 / HER2 / CD340 Reference Antibody (Hersintuzumab)(CHA834) is expressed from CHO. The heavy chain type…
Product Name : Anti-EphA3 Reference Antibody (ifabotuzumab)synonym : null,productDescription : Anti-EphA3 Reference Antibody (ifabotuzumab)(CHA833) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-BTLA / CD272 Reference Antibody (icatolimab)synonym : null,productDescription : Anti-BTLA / CD272 Reference Antibody (icatolimab)(CHA832) is expressed from CHO. The heavy chain type is huIgG4SP, and the…
Product Name : Anti-CD20 / MS4A1 Reference Antibody (ibritumomab)synonym : null,productDescription : Anti-CD20 Reference Antibody (ibritumomab)(CHA831) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-ER-Beta Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 59endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-ERBB1 / EGFR / HER1 Reference Antibody (zalutumumab)synonym : null,productDescription : Anti-ERBB1 / EGFR / HER1 Reference Antibody (zalutumumab)(CHA829) is expressed from CHO. The heavy chain type…
Product Name : Anti-ERBB1 / EGFR / HER1 Reference Antibody (Shanghai Cancer Inst patent anti-EGFRvIII)synonym : null,productDescription : Anti-ERBB1 / EGFR / HER1 Reference Antibody (Shanghai Cancer Inst patent anti-EGFRvIII)(CHA826)…
Product Name : Anti-ERBB1 / EGFR / HER1 Reference Antibody (SerclutamAb)synonym : null,productDescription : Anti-ERBB1 / EGFR / HER1 Reference Antibody (SerclutamAb)(CHA825) is expressed from CHO. The heavy chain type…
Product Name : Anti-ERBB1 / EGFR / HER1 Reference Antibody (pimurutamab)synonym : null,productDescription : Anti-ERBB1 / EGFR / HER1 Reference Antibody (pimurutamab)(CHA823) is expressed from CHO. The heavy chain type…
Product Name : Anti-TNFSF2 / TNFa Reference Antibody (golimumab)synonym : null,productDescription : Anti-TNFSF2 / TNFa Reference Antibody (golimumab)(CHA819) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-ERBB1 / EGFR / HER1 Reference Antibody (necitumumab)synonym : null,productDescription : Anti-ERBB1 / EGFR / HER1 Reference Antibody (necitumumab)(CHA818) is expressed from CHO. The heavy chain type…
Product Name : Anti-ERBB1 / EGFR / HER1 Reference Antibody (matuzumab)synonym : null,productDescription : Anti-ERBB1 / EGFR / HER1 Reference Antibody (matuzumab)(CHA817) is expressed from CHO. The heavy chain type…
Product Name : Anti-ERBB1 / EGFR / HER1 Reference Antibody (laprituximab)synonym : null,productDescription : Anti-ERBB1 / EGFR / HER1 Reference Antibody (laprituximAb)(CHA815) is expressed from CHO. The heavy chain type…
Product Name : Anti-ERBB1 / EGFR / HER1 Reference Antibody (imgatuzumab)synonym : null,productDescription : Anti-ERBB1 / EGFR / HER1 Reference Antibody (imgatuzumab)(CHA814) is expressed from CHO. The heavy chain type…
Product Name : Anti-ERBB1 / EGFR / HER1 Reference Antibody (Duke D2C7)synonym : null,productDescription : Anti-ERBB1 / EGFR / HER1 Reference Antibody (Duke D2C7)(CHA813) is expressed from CHO. The heavy…
Product Name : Anti-EpCAM / TROP1 / CD326 Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 35endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity :…
Product Name : Anti-ERBB1 / EGFR / HER1 Reference Antibody (depatuxizumab)synonym : null,productDescription : Anti-ERBB1 / EGFR / HER1 Reference Antibody (depatuxizumab)(CHA812) is expressed from CHO. The heavy chain type…
Product Name : Anti-AMACR/p504s Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 42 kDaendotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : Humanconcentration : Ready-to-useAntibodies…
Product Name : Anti-ERBB1 / EGFR / HER1 Reference Antibody (demupitamab)synonym : null,productDescription : Anti-ERBB1 / EGFR / HER1 Reference Antibody (demupitamab)(CHA811) is expressed from CHO. The heavy chain type…
Product Name : Anti-ERBB1 / EGFR / HER1 Reference Antibody (Chinese Mil.Med.Sci. patent anti-EGFR)synonym : null,productDescription : Anti-ERBB1 / EGFR / HER1 Reference Antibody (Chinese Mil.Med.Sci. patent anti-EGFR)(CHA810) is expressed…
Product Name : Anti-ERBB1 / EGFR / HER1 Reference Antibody (7A7)synonym : null,productDescription : Anti-ERBB1 / EGFR / HER1 Reference Antibody (7A7)(CHA809) is expressed from CHO. The heavy chain type…
Product Name : Anti-TNFRSF5 / CD40 Reference Antibody (giloralimab)synonym : null,productDescription : Anti-TNFRSF5 / CD40 Reference Antibody (giloralimab)(CHA808) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-IL-1b Reference Antibody (gevokizumab)synonym : null,productDescription : Anti-IL-1b Reference Antibody (gevokizumab)(CHA807) is expressed from CHO. The heavy chain type is huIgG2, and the light chain type is…
Product Name : Anti-PDCD1 / PD-1 / CD279 Reference Antibody (geptanolimab)synonym : null,productDescription : Anti-PDCD1 / PD-1 / CD279 Reference Antibody (geptanolimab)(CHA806) is expressed from CHO. The heavy chain type…
Product Name : Anti-Amyloid Beta Reference Antibody (Georgetown U. patent anti-Amyloid Beta)synonym : null,productDescription : Anti-Amyloid Beta Reference Antibody (Georgetown U. patent anti-Amyloid Beta)(CHA805) is expressed from CHO. The heavy…
Product Name : Anti-EpCAM / TROP1 / CD326 Reference Antibody (adecatumumab)synonym : null,productDescription : Anti-EpCAM / TROP1 / CD326 Reference Antibody (adecatumumab)(CHA804) is expressed from CHO. The heavy chain type…
Product Name : Anti-NOTCH3 Reference Antibody (Genentech patent anti-Notch3)synonym : null,productDescription : Anti-NOTCH3 Reference Antibody (Genentech patent anti-Notch3)(CHA802) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-MUC1 Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 122endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-Complement Factor B Reference Antibody (Genentech patent anti-Factor B)synonym : null,productDescription : Anti-Complement Factor B Reference Antibody (Genentech patent anti-Factor B)(CHA801) is expressed from CHO. The heavy…
Product Name : Anti-EGFL7 Reference Antibody (parsatuzumab)synonym : null,productDescription : Anti-EGFL7 Reference Antibody (parsatuzumab)(CHA800) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-MUC1 Reference Antibody (gatipotuzumab)synonym : null,productDescription : Anti-MUC1 Reference Antibody (gatipotuzumab)(CHA799) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-ERBB2 / HER2 / CD340 Reference Antibody (gancotamab)synonym : null,productDescription : Anti-ERBB2 / HER2 / CD340 Reference Antibody (gancotamab)(CHA798) is expressed from CHO. The heavy chain type…
Product Name : Anti-DLL4 Reference Antibody (Smart Targeting patent anti-DLL4)synonym : null,productDescription : Anti-DLL4 Reference Antibody (Smart Targeting patent anti-DLL4)(CHA797) is expressed from CHO. The heavy chain type is huIgG1,…
Product Name : Anti-PCSK9 Reference Antibody (frovocimab)synonym : null,productDescription : Anti-PCSK9 Reference Antibody (frovocimab)(CHA796) is expressed from CHO. The heavy chain type is huIgG4SP, and the light chain type is…
Product Name : Anti-TEM7R / PLXDC2 Reference Antibody (Fox Chase patent anti-TEM7R)synonym : null,productDescription : Anti-TEM7R / PLXDC2 Reference Antibody (Fox Chase patent anti-TEM7R)(CHA792) is expressed from CHO. The heavy…
Product Name : Anti-TGFb1 Reference Antibody (fresolimumab)synonym : null,productDescription : Anti-TGFb1 Reference Antibody (fresolimumab)(CHA793) is expressed from CHO. The heavy chain type is huIgG4SP, and the light chain type is…
Product Name : Anti-MUC17 Reference Antibody (Forerunner patent anti-Muc 17)synonym : null,productDescription : Anti-MUC17 Reference Antibody (Forerunner patent anti-Muc 17)(CHA789) is expressed from CHO. The heavy chain type is huIgG1,…
Product Name : Anti-ICAM3 / CD50 Reference Antibody (Forerunner patent anti-ICAM-3)synonym : null,productDescription : Anti-ICAM3 / CD50 Reference Antibody (Forerunner patent anti-ICAM-3)(CHA788) is expressed from CHO. The heavy chain type…
Product Name : Anti-ERBB1 / EGFR / HER1 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 134endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity :…
Product Name : Anti-CXCR4 / CD184 Reference Antibody (Dana-Farber patent anti-CXCR4)synonym : null,productDescription : Anti-CXCR4 / CD184 Reference Antibody (Dana-Farber patent anti-CXCR4)(CHA786) is expressed from CHO. The heavy chain type…
Product Name : Anti-CD3e Reference Antibody (foralumab)synonym : null,productDescription : Anti-CD3e Reference Antibody (foralumab)(CHA785) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-CXCL8 / IL-8 Reference Antibody (Genentech patent anti-IL-8)synonym : null,productDescription : Anti-CXCL8 / IL-8 Reference Antibody (Genentech patent anti-IL-8)(CHA784) is expressed from CHO. The heavy chain type…
Product Name : Anti-CXCL8 / IL-8 Reference Antibody (ABX-IL8)synonym : null,productDescription : Anti-CXCL8 / IL-8 Reference Antibody (ABX-IL8)(CHA783) is expressed from CHO. The heavy chain type is huIgG2, and the…
Product Name : Anti-CXCL12 / SDF1a Reference Antibody (Genentech anti-CXCL12)synonym : null,productDescription : Anti-CXCL12 / SDF1a Reference Antibody (Genentech anti-CXCL12)(CHA782) is expressed from CHO. The heavy chain type is huIgG1,…
Product Name : Anti-IFNg Reference Antibody (fontolizumab)synonym : null,productDescription : Anti-IFNg Reference Antibody (fontolizumab)(CHA780) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-CXCL10 / IP-10 Reference Antibody (NI-0801)synonym : null,productDescription : Anti-CXCL10 / IP-10 Reference Antibody (NI-0801)(CHA781) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-CTLA-8 / IL-17a Reference Antibody (vunakizumab)synonym : null,productDescription : Anti-CTLA-8 / IL-17a Reference Antibody (vunakizumab)(CHA779) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-CTLA-8 / IL-17a Reference Antibody (UCB patent anti-IL-17)synonym : null,productDescription : Anti-CTLA-8 / IL-17a Reference Antibody (UCB patent anti-IL-17)(CHA778) is expressed from CHO. The heavy chain type…
Product Name : Anti-CTLA-8 / IL-17a Reference Antibody (perakizumab)synonym : null,productDescription : Anti-CTLA-8 / IL-17a Reference Antibody (perakizumab)(CHA776) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-CDH1 / E-cadherin / CD324 Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 97endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity :…
Product Name : Anti-CTLA-8 / IL-17a Reference Antibody (ixekizumab)synonym : null,productDescription : Anti-CTLA-8 / IL-17a Reference Antibody (ixekizumab)(CHA774) is expressed from CHO. The heavy chain type is huIgG4SP, and the…
Product Name : Anti-CTLA-8 / IL-17a Reference Antibody (netakimab)synonym : null,productDescription : Anti-CTLA-8 / IL-17a Reference Antibody (netakimab)(CHA775) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-CTLA-8 / IL-17a Reference Antibody (CAT-2200)synonym : null,productDescription : Anti-CTLA-8 / IL-17a Reference Antibody (CAT-2200)(CHA773) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-CTLA-4 / CD152 Reference Antibody (zalifrelimab)synonym : null,productDescription : Anti-CTLA-4 / CD152 Reference Antibody (zalifrelimab)(CHA772) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-CTLA-4 / CD152 Reference Antibody (nurulimab)synonym : null,productDescription : Anti-CTLA-4 / CD152 Reference Antibody (nurulimab)(CHA768) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-CTLA-4 / CD152 Reference Antibody (tremelimumab)synonym : null,productDescription : Anti-CTLA-4 / CD152 Reference Antibody (tremelimumab)(CHA770) is expressed from CHO. The heavy chain type is huIgG2, and the…
Product Name : Anti-TRP1 / TYRP1 Reference Antibody (flanvotumab)synonym : null,productDescription : Anti-TRP1 / TYRP1 Reference Antibody (flanvotumab)(CHA767) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-PDCD1 / PD-1 / CD279 Reference Antibody (finotonlimab)synonym : null,productDescription : Anti-PDCD1 / PD-1 / CD279 Reference Antibody (finotonlimab)(CHA766) is expressed from CHO. The heavy chain type…
Product Name : Anti-Sphingosine-1-phosphate Reference Antibody (Expression DD patent anti-SIP)synonym : null,productDescription : Anti-Sphingosine-1-phosphate Reference Antibody (Expression DD patent anti-SIP)(CHA763) is expressed from CHO. The heavy chain type is huIgG1,…
Product Name : Anti-PCSK9 Reference Antibody (evolocumab)synonym : null,productDescription : Anti-PCSK9 Reference Antibody (evolocumab)(CHA762) is expressed from CHO. The heavy chain type is huIgG2, and the light chain type is…
Product Name : Anti-DPC4 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 60endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-Integrin a4b7 (ITGA4 & ITGB7) Reference Antibody (etrolizumab)synonym : null,productDescription : Anti-Integrin a4b7 (ITGA4 & ITGB7) Reference Antibody (etrolizumab)(CHA761) is expressed from CHO. The heavy chain type…
Product Name : Anti-CSF2 / GM-CSF Reference Antibody (namilumab)synonym : null,productDescription : Anti-CSF2 / GM-CSF Reference Antibody (namilumab)(CHA760) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-CSF2 / GM-CSF Reference Antibody (lenzilumab)synonym : null,productDescription : Anti-CSF2 / GM-CSF Reference Antibody (lenzilumab)(CHA759) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-CSF1R / M-CSFR / CD115 Reference Antibody (LY3022855)synonym : null,productDescription : Anti-CSF1R / M-CSFR / CD115 Reference Antibody (LY3022855)(CHA757) is expressed from CHO. The heavy chain type…
Product Name : Anti-CSF2 / GM-CSF Reference Antibody (gimsilumab)synonym : productDescription : Anti-CSF2 / GM-CSF Reference Antibody (gimsilumab)(CHA758) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-CSF1R / M-CSFR / CD115 Reference Antibody (emactuzumab)synonym : null,productDescription : Anti-CSF1R / M-CSFR / CD115 Reference Antibody (emactuzumab)(CHA756) is expressed from CHO. The heavy chain type…
Product Name : Anti-TNFSF2 / TNFa Reference Antibody (Epitomics patent anti-TNFα)synonym : null,productDescription : Anti-TNFSF2 / TNFa Reference Antibody (Epitomics patent anti-TNFα)(CHA754) is expressed from CHO. The heavy chain type…
Product Name : Anti-Complement Factor D Reference Antibody (lampalizumab)synonym : null,productDescription : Anti-Complement Factor D Reference Antibody (lampalizumab)(CHA752) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-Complement C5aR1 Reference Antibody (G2 patent anti-C5aR)synonym : null,productDescription : Anti-Complement C5aR1 Reference Antibody (G2 patent anti-C5aR)(CHA750) is expressed from CHO. The heavy chain type is huIgG1,…
Product Name : Anti-DLL4 Reference Antibody (enoticumab)synonym : null,productDescription : Anti-DLL4 Reference Antibody (enoticumab)(CHA749) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-ANO1 / TMEM16ARabbit mAbsynonym : null,productDescription : NonemolecularWeight : 114endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies…
Product Name : Anti-Complement C5 Reference Antibody (ravulizumab)synonym : null,productDescription : Anti-Complement C5 Reference Antibody (ravulizumab)(CHA747) is expressed from CHO. The heavy chain type is huIgG2, and the light chain…
Product Name : Anti-Complement C5 Reference Antibody (lendalizumab)synonym : null,productDescription : Anti-Complement C5 Reference Antibody (lendalizumab)(CHA745) is expressed from CHO. The heavy chain type is huIgG2, and the light chain…
Product Name : Anti-AXL / UFO Reference Antibody (enapotamab)synonym : productDescription : Anti-AXL / UFO Reference Antibody (enapotamab)(CHA744) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-CLEC4C Reference Antibody (LFB patent anti-BDCA-2)synonym : null,productDescription : Anti-CLEC4C Reference Antibody (LFB patent anti-BDCA-2)(CHA743) is expressed from CHO. It has a predicted MW of 146.34 kDa.molecularWeight…
Product Name : Anti-CLEC4C Reference Antibody (BIIB059)synonym : null,productDescription : Anti-CLEC4C Reference Antibody (BIIB059)(CHA742) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-TNFRSF5 / CD40 Reference Antibody (Emory U. anti-CD40)synonym : null,productDescription : Anti-TNFRSF5 / CD40 Reference Antibody (Emory U. anti-CD40)(CHA741) is expressed from CHO. The heavy chain type…
Product Name : Anti-IL-6 / IFNb2 Reference Antibody (elsilimomab)synonym : null,productDescription : Anti-IL-6 / IFNb2 Reference Antibody (elsilimomab)(CHA740) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-CEACAM6 / CD66c Reference Antibody (tinurilimab)synonym : null,productDescription : Anti-CEACAM6 / CD66c Reference Antibody (tinurilimab)(CHA737) is expressed from CHO. The heavy chain type is huIgG2, and the…
Product Name : Anti-Desmin Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 54endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-PCSK9 Reference Antibody (ebronucimab)synonym : null,productDescription : Anti-PCSK9 Reference Antibody (ebronucimab)(CHA736) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-CEACAM5 / CEA / CD66e Reference Antibody (Tusamitamab)synonym : null,productDescription : Anti-CEACAM5 / CEA / CD66e Reference Antibody (tusamitamab)(CHA735) is expressed from CHO. The heavy chain type…
Product Name : Anti-IL-12b Reference Antibody (ebdarokimab)synonym : null,productDescription : Anti-IL-12b Reference Antibody (ebdarokimab)(CHA733) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-CEACAM5 / CEA / CD66e Reference Antibody (cergutuzumAb)synonym : null,productDescription : Anti-CEACAM5 / CEA / CD66e Reference Antibody (cergutuzumAb)(CHA731) is expressed from CHO. The heavy chain type…
Product Name : Anti-CEACAM1 / CD66a Reference Antibody (Chaim Sheba Med. Cntr. patent anti-CEACAM1)synonym : null,productDescription : Anti-CEACAM1 / CD66a Reference Antibody (Chaim Sheba Med. Cntr. patent anti-CEACAM1)(CHA730) is expressed…
Product Name : Anti-CDH3 / P-cadherin Reference Antibody (PF-03732010)synonym : null,productDescription : Anti-CDH3 / P-cadherin Reference Antibody (PF-03732010)(CHA727) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-CD9 Reference Antibody (Genentech patent anti-CD9)synonym : null,productDescription : Anti-CD9 Reference Antibody (Genentech patent anti-CD9)(CHA725) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-CDH1 / E-cadherin / CD324 Reference Antibody (Stem Centrx patent anti-Cadherin-1)synonym : null,productDescription : Anti-CDH1 / E-cadherin / CD324 Reference Antibody (Stem Centrx patent anti-Cadherin-1)(CHA726) is expressed…
Product Name : Anti-CD83 Reference Antibody (Genentech patent anti-CD83)synonym : null,productDescription : Anti-CD83 Reference Antibody (Genentech patent anti-CD83)(CHA724) is expressed from CHO. The heavy chain type is huIgG2, and the…
Product Name : Anti-PDCD1 / PD-1 / CD279 Reference Antibody (dostarlimab)synonym : null,productDescription : Anti-PDCD1 / PD-1 / CD279 Reference Antibody (dostarlimab)(CHA722) is expressed from CHO. The heavy chain type…
Product Name : Anti-CD79b Reference Antibody (iladatuzumAb)synonym : null,productDescription : Anti-CD79b Reference Antibody (iladatuzumAb)(CHA723) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-CD7 Reference Antibody (grisnilimAb)synonym : null,productDescription : Anti-CD7 Reference Antibody (grisnilimAb)(CHA721) is expressed from CHO. The heavy chain type is huIgG2, and the light chain type is…
Product Name : Anti-Cyclin D1 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 34endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies…
Product Name : Anti-Amyloid Beta Reference Antibody (donanemab)synonym : null,productDescription : Anti-Amyloid Beta Reference Antibody (donanemab)(CHA720) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-TIGIT Reference Antibody (domvanalimab)synonym : null,productDescription : Anti-TIGIT Reference Antibody (domvanalimab)(CHA719) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-CD59 Reference Antibody (Quark patent anti-CD59)synonym : null,productDescription : Anti-CD59 Reference Antibody (Quark patent anti-CD59)(CHA718) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-CD52 Reference Antibody (gatralimab)synonym : null,productDescription : Anti-CD52 Reference Antibody (gatralimab)(CHA717) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-FOLR1 / FRA Reference Antibody (Dompe patent anti-FOLR1)synonym : null,productDescription : Anti-FOLR1 Reference Antibody (Dompe patent anti-FOLR1)(CHA716) is expressed from CHO. The heavy chain type is huIgG1,…
Product Name : Anti-VEGF Reference Antibody (Domantis patent anti-VEGF)synonym : null,productDescription : Anti-VEGF Reference Antibody (Domantis patent anti-VEGF)(CHA715) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-CD47 Reference Antibody (urabrelimab)synonym : null,productDescription : Anti-CD47 Reference Antibody (urabrelimab)(CHA714) is expressed from CHO. The heavy chain type is huIgG4SP, and the light chain type is…
Product Name : Anti-CD47 Reference Antibody (letaplimab)synonym : null,productDescription : Anti-CD47 Reference Antibody (letaplimab)(CHA711) is expressed from CHO. The heavy chain type is huIgG4SP, and the light chain type is…
Product Name : Anti-CD47 Reference Antibody (ligufalimab)synonym : null,productDescription : Anti-CD47 Reference Antibody (ligufalimab)(CHA712) is expressed from CHO. The heavy chain type is huIgG4SP, and the light chain type is…
Product Name : Anti-COX-2 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 69endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-CD20 / MS4A1 Reference Antibody (divozilimab)synonym : null,productDescription : Anti-CD20 Reference Antibody (divozilimab)(CHA710) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-Histone H1 Reference Antibody (derlotuximab)synonym : null,productDescription : Anti-Histone H1 Reference Antibody (derlotuximab)(CHA709) is expressed from CHO. The heavy chain type is huIgG4PE, and the light chain…
Product Name : Anti-IL-5 Reference Antibody (depemokimab)synonym : null,productDescription : Anti-IL-5 Reference Antibody (depemokimab)(CHA708) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-CD4 Reference Antibody (TRX1)synonym : null,productDescription : Anti-CD4 Reference Antibody (TRX1)(CHA707) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-CD4 Reference Antibody (tregalizumab)synonym : null,productDescription : Anti-CD4 Reference Antibody (tregalizumab)(CHA706) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-CD4 Reference Antibody (ibalizumab)synonym : null,productDescription : Anti-CD4 Reference Antibody (ibalizumab)(CHA704) is expressed from CHO. The heavy chain type is huIgG4SP, and the light chain type is…
Product Name : Anti-CD38 Reference Antibody (mezagitamab)synonym : null,productDescription : Anti-CD38 Reference Antibody (mezagitamab)(CHA703) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-CD38 Reference Antibody (isatuximab)synonym : null,productDescription : Anti-CD38 Reference Antibody (isatuximab)(CHA701) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-CD38 Reference Antibody (felzartamab)synonym : null,productDescription : Anti-CD38 Reference Antibody (felzartamab)(CHA700) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-CD34 Reference Antibody (ITRI patent anti-CD34)synonym : null,productDescription : Anti-CD34 Reference Antibody (ITRI patent anti-CD34)(CHA699) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-Collagen Type IV Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 161endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration :…
Product Name : Anti-CD3 Reference Antibody (visilizumab)synonym : null,productDescription : Anti-CD3 Reference Antibody (visilizumab)(CHA697) is expressed from CHO. The heavy chain type is huIgG2SA, and the light chain type is…
Product Name : Anti-IGF1R / CD221 Reference Antibody (dalotuzumab)synonym : null,productDescription : Anti-IGF1R / CD221 Reference Antibody (dalotuzumab)(CHA694) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-TNFSF5 / CD40L / CD154 Reference Antibody (dapirolizumab)synonym : null,productDescription : Anti-TNFSF5 / CD40L / CD154 Reference Antibody (dapirolizumab)(CHA696) is expressed from CHO. The heavy chain type…
Product Name : Anti-TNFRSF4 / OX40 / CD134 Reference Antibody (cudarolimab)synonym : null,productDescription : Anti-TNFRSF4 / OX40 / CD134 Reference Antibody (cudarolimab)(CHA692) is expressed from CHO. The heavy chain type…
Product Name : Anti-B7-H1 / PD-L1 / CD274 Reference Antibody (cosibelimab)synonym : null,productDescription : Anti-B7-H1 / PD-L1 / CD274 Reference Antibody (cosibelimab)(CHA685) is expressed from CHO. The heavy chain type…
Product Name : Anti-Complement C5 Reference Antibody (crovalimab)synonym : null,productDescription : Anti-Complement C5 Reference Antibody (crovalimab)(CHA690) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-ERBB2 / HER2 / CD340 Reference Antibody (coprelotamab)synonym : null,productDescription : Anti-ERBB2 / HER2 / CD340 Reference Antibody (coprelotamab)(CHA684) is expressed from CHO. The heavy chain type…
Product Name : Anti-CD28L / CD80 Reference Antibody (galiximab)synonym : null,productDescription : Anti-CD28L / CD80 Reference Antibody (galiximab)(CHA680) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-CD20 / MS4A1 Reference Antibody (zuberitamab)synonym : null,productDescription : Anti-CD20 Reference Antibody (zuberitamab)(CHA678) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-CD28 Reference Antibody (FR104)synonym : null,productDescription : Anti-CD28 Reference Antibody (FR104)(CHA679) is expressed from CHO. The heavy chain type is huIgG2, and the light chain type is…
Product Name : Anti-c-MYC Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 49endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-Alpha-1-Fetoprotein Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 69 kDaendotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : Humanconcentration : Ready-to-useAntibodies…
Product Name : Anti-CD20 / MS4A1 Reference Antibody (veltuzumab)synonym : null,productDescription : Anti-CD20 Reference Antibody (veltuzumab)(CHA677) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-CD20 / MS4A1 Reference Antibody (ublituximab)synonym : null,productDescription : Anti-CD20 Reference Antibody (ublituximab)(CHA675) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-CD20 / MS4A1 Reference Antibody (ripertamab)synonym : null,productDescription : Anti-CD20 Reference Antibody (ripertamab)(CHA671) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-CD20 / MS4A1 Reference Antibody (TRU-015)synonym : null,productDescription : Anti-CD20 Reference Antibody (TRU-015)(CHA673) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-CD19 Reference Antibody (coltuximab)synonym : null,productDescription : Anti-CD19 Reference Antibody (coltuximab)(CHA668) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-TFPI Reference Antibody (concizumab)synonym : null,productDescription : Anti-TFPI Reference Antibody (concizumab)(CHA669) is expressed from CHO. The heavy chain type is huIgG4SP, and the light chain type is…
Product Name : Anti-PTK7 / CCK4 Reference Antibody (cofetuzumab)synonym : null,productDescription : Anti-PTK7 / CCK4 Reference Antibody (cofetuzumab)(CHA667) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-TIM-3 / HAVCR2 / CD366 Reference Antibody (cobolimab)synonym : null,productDescription : Anti-TIM-3 / HAVCR2 / CD366 Reference Antibody (cobolimab)(CHA666) is expressed from CHO. The heavy chain type…
Product Name : Anti-TLR3 / CD283 Reference Antibody (CNTO5429)synonym : null,productDescription : Anti-TLR3 / CD283 Reference Antibody (CNTO5429)(CHA665) is expressed from CHO. The heavy chain type is huIgG2, and the…
Product Name : Anti-IL-13 Reference Antibody (CNTO 607)synonym : null,productDescription : Anti-IL-13 Reference Antibody (CNTO 607)(CHA664) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-HGFR / c-Met Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 156endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration :…
Product Name : Anti-IFNa1 Reference Antibody (Chinese CDC patent anti-Interferon Alpha)synonym : null,productDescription : Anti-IFNa1 Reference Antibody (Chinese CDC patent anti-Interferon Alpha)(CHA661) is expressed from CHO. The heavy chain type…
Product Name : Anti-Amyloid Beta Reference Antibody (CNTO 2125)synonym : null,productDescription : Anti-Amyloid Beta Reference Antibody (CNTO 2125)(CHA662) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-TNFSF2 / TNFa Reference Antibody (certolizumAb)synonym : null,productDescription : Anti-TNFSF2 / TNFa Reference Antibody (certolizumAb)(CHA656) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-CD2 Reference Antibody (siplizumab)synonym : null,productDescription : Anti-CD2 Reference Antibody (siplizumab)(CHA659) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-CD19 Reference Antibody (Duke U. patent anti-CD19)synonym : null,productDescription : Anti-CD19 Reference Antibody (Duke U. patent anti-CD19)(CHA654) is expressed from CHO. The heavy chain type is huIgG1,…
Product Name : Anti-IL-25 Reference Antibody (Centocor patent anti-IL-25)synonym : null,productDescription : Anti-IL-25 Reference Antibody (Centocor patent anti-IL-25)(CHA655) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-CD19 Reference Antibody (denintuzumab)synonym : null,productDescription : Anti-CD19 Reference Antibody (denintuzumab)(CHA653) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-CD151 Reference Antibody (Pierre Fabre patent anti-CD151)synonym : null,productDescription : Anti-CD151 Reference Antibody (Pierre Fabre patent anti-CD151)(CHA650) is expressed from CHO. The heavy chain type is huIgG1,…
Product Name : Anti-EMMPRIN / CD147 Reference Antibody (Centocor patent anti-CD147)synonym : null,productDescription : Anti-EMMPRIN / CD147 Reference Antibody (Centocor patent anti-CD147)(CHA651) is expressed from CHO. The heavy chain type…
Product Name : Anti-CCL5 / RANTES Reference Antibody (NI-0701)synonym : null,productDescription : Anti-CCL5 / RANTES Reference Antibody (NI-0701)(CHA648) is expressed from CHO. The heavy chain type is huIgG2, and the…
Product Name : Anti-CK20 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 48endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-CCL2 / MCP1 Reference Antibody (carlumab)synonym : null,productDescription : Anti-CCL2 / MCP1 Reference Antibody (carlumab)(CHA647) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-ABCB5 Reference Antibody (Brigham and Women’s patent anti-ABCB5)synonym : null,productDescription : Anti-ABCB5 Reference Antibody (Brigham and Women’s patent anti-ABCB5)(CHA644) is expressed from CHO. The heavy chain type…
Product Name : Anti-CB1 / CNR1 Reference Antibody (nimacimab)synonym : productDescription : Anti-CB1 / CNR1 Reference Antibody (nimacimab)(CHA645) is expressed from CHO. The heavy chain type is huIgG4SP, and the…
Product Name : Anti-CALCA / CGRP Reference Antibody (galcanezumab)synonym : null,productDescription : Anti-CALCA / CGRP Reference Antibody (galcanezumab)(CHA642) is expressed from CHO. The heavy chain type is huIgG4SP, and the…
Product Name : Anti-CALCA / CGRP Reference Antibody (fremanezumab)synonym : null,productDescription : Anti-CALCA / CGRP Reference Antibody (fremanezumab)(CHA640) is expressed from CHO. The heavy chain type is huIgG2, and the…
Product Name : Anti-CALCA / CGRP Reference Antibody (eptinezumab)synonym : null,productDescription : Anti-CALCA / CGRP Reference Antibody (eptinezumab)(CHA638) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-PCSK9 Reference Antibody (Boehringer anti-PCSK9)synonym : null,productDescription : Anti-PCSK9 Reference Antibody (Boehringer anti-PCSK9)(CHA637) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-SOST / Sclerostin Reference Antibody (blosozumab)synonym : null,productDescription : Anti-SOST / Sclerostin Reference Antibody (blosozumab)(CHA635) is expressed from CHO. The heavy chain type is huIgG4SP, and the…
Product Name : Anti-PCSK9 Reference Antibody (bococizumab)synonym : null,productDescription : Anti-PCSK9 Reference Antibody (bococizumab)(CHA636) is expressed from CHO. The heavy chain type is huIgG2, and the light chain type is…
Product Name : Anti-BACE1 Reference Antibody (Genentech anti-BACE1)synonym : null,productDescription : Anti-BACE1 Reference Antibody (Genentech anti-BACE1)(CHA629) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-CK19 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 44endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-B7-H4 / VTCN1 Reference Antibody (Millennium patent anti-B7-H4)synonym : null,productDescription : Anti-B7-H4 / VTCN1 Reference Antibody (Millennium patent anti-B7-H4)(CHA628) is expressed from CHO. The heavy chain type…
Product Name : Anti-B7-H4 / VTCN1 Reference Antibody (alsevalimab)synonym : productDescription : Anti-B7-H4 / VTCN1 Reference Antibody (alsevalimab)(CHA627) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-B7-H3 / CD276 Reference Antibody (Trellis patent anti-B7-H3)synonym : null,productDescription : Anti-B7-H3 / CD276 Reference Antibody (Trellis patent anti-B7-H3)(CHA626) is expressed from CHO. The heavy chain type…
Product Name : Anti-B7-H2 / ICOSL / CD275 Reference Antibody (prezalumab)synonym : null,productDescription : Anti-B7-H2 / ICOSL / CD275 Reference Antibody (prezalumab)(CHA621) is expressed from CHO. The heavy chain type…
Product Name : Anti-B7-H1 / PD-L1 / CD274 Reference Antibody (sugemalimab)synonym : null,productDescription : Anti-B7-H1 / PD-L1 / CD274 Reference Antibody (sugemalimab)(CHA620) is expressed from CHO. The heavy chain type…
Product Name : Anti-B7-H1 / PD-L1 / CD274 Reference Antibody (sudubrilimab)synonym : null,productDescription : Anti-B7-H1 / PD-L1 / CD274 Reference Antibody (sudubrilimab)(CHA619) is expressed from CHO. The heavy chain type…
Product Name : Anti-B7-H1 / PD-L1 / CD274 Reference Antibody (pacmilimab)synonym : null,productDescription : Anti-B7-H1 / PD-L1 / CD274 Reference Antibody (pacmilimab)(CHA618) is expressed from CHO. The heavy chain type…
Product Name : Anti-DPP4 / CD26 Reference Antibody (begelomab)synonym : null,productDescription : Anti-DPP4 / CD26 Reference Antibody (begelomab)(CHA617) is expressed from CHO. The heavy chain type is huIgG2, and the…
Product Name : Anti-B7-H1 / PD-L1 / CD274 Reference Antibody (manelimab)synonym : null,productDescription : Anti-B7-H1 / PD-L1 / CD274 Reference Antibody (manelimab)(CHA616) is expressed from CHO. The heavy chain type…
Product Name : Anti-CK18 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 48endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-TFPI Reference Antibody (befovacimab)synonym : null,productDescription : Anti-TFPI Reference Antibody (befovacimab)(CHA615) is expressed from CHO. The heavy chain type is huIgG2, and the light chain type is…
Product Name : Anti-B7-H1 / PD-L1 / CD274 Reference Antibody (garivulimab)synonym : null,productDescription : Anti-B7-H1 / PD-L1 / CD274 Reference Antibody (garivulimab)(CHA614) is expressed from CHO. The heavy chain type…
Product Name : Anti-IFNa1 Reference Antibody (Baylor patent anti-IFN alpha)synonym : null,productDescription : Anti-IFNa1 Reference Antibody (Baylor patent anti-IFN alpha)(CHA613) is expressed from CHO. The heavy chain type is huIgG1,…
Product Name : Anti-FcRn (FCGRT & B2M) Reference Antibody (batoclimab)synonym : null,productDescription : Anti-FcRn (FCGRT & B2M) Reference Antibody (batoclimab)(CHA612) is expressed from CHO. The heavy chain type is huIgG1,…
Product Name : Anti-B7-H1 / PD-L1 / CD274 Reference Antibody (adebrelimab)synonym : null,productDescription : Anti-B7-H1 / PD-L1 / CD274 Reference Antibody (adebrelimab)(CHA611) is expressed from CHO. The heavy chain type…
Product Name : Anti-AXL / UFO Reference Antibody (tilvestamab)synonym : productDescription : Anti-AXL / UFO Reference Antibody (tilvestamab)(CHA610) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-MSPR / RON / CD136 Reference Antibody (Aveo anti-RON)synonym : null,productDescription : Anti-MSPR / RON / CD136 Reference Antibody (Aveo anti-RON)(CHA607) is expressed from CHO. The heavy…
Product Name : Anti-Complement C5aR1 Reference Antibody (avdoralimab)synonym : null,productDescription : Anti-Complement C5aR1 Reference Antibody (avdoralimab)(CHA606) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-IL-1RL1 / ST2 / IL-33R Reference Antibody (astegolimab)synonym : null,productDescription : Anti-IL-1RL1 / ST2 / IL-33R Reference Antibody (astegolimab)(CHA605) is expressed from CHO. The heavy chain type…
Product Name : Anti-ANGPTL4 Reference Antibody (Nanyang Tech.U. patent anti-ANGPTL4)synonym : null,productDescription : Anti-ANGPTL4 Reference Antibody (Nanyang Tech.U. patent anti-ANGPTL4)(CHA604) is expressed from CHO. The heavy chain type is huIgG1,…
Product Name : Anti-ANGPT2 Reference Antibody (zansecimab)synonym : null,productDescription : Anti-ANGPT2 Reference Antibody (zansecimab)(CHA602) is expressed from CHO. The heavy chain type is huIgG4SP, and the light chain type is…
Product Name : Anti-CK17 Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 48endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-GDF8 / Myostatin Reference Antibody (apitegromab)synonym : null,productDescription : Anti-GDF8 / Myostatin Reference Antibody (apitegromab)(CHA601) is expressed from CHO. The heavy chain type is huIgG4SP, and the…
Product Name : Anti-ANGPT2 Reference Antibody (MEDI3617)synonym : null,productDescription : Anti-ANGPT2 Reference Antibody (MEDI3617)(CHA600) is expressed from CHO. The heavy chain type is huIgG2, and the light chain type is…
Product Name : Anti-Amyloid Beta Reference Antibody (Amgen patent anti-beta amyloid)synonym : null,productDescription : Anti-Amyloid Beta Reference Antibody (Amgen patent anti-beta amyloid)(CHA597) is expressed from CHO. The heavy chain type…
Product Name : Anti-ICOS / CD278 Reference Antibody (alomfilimab)synonym : productDescription : Anti-ICOS / CD278 Reference Antibody (alomfilimab)(CHA596) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-vWF Reference Antibody (Ajinomoto patent anti-vWF)synonym : null,productDescription : Anti-vWF Reference Antibody (Ajinomoto patent anti-vWF)(CHA594) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-Amyloid Beta Reference Antibody (GSK 933776)synonym : null,productDescription : Anti-Amyloid Beta Reference Antibody (GSK 933776)(CHA592) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-Cdiff Toxin A Reference Antibody (actoxumab)synonym : null,productDescription : Anti-Cdiff Toxin A Reference Antibody (actoxumab)(CHA591) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-Amyloid Beta Reference Antibody (gantenerumab)synonym : null,productDescription : Anti-Amyloid Beta Reference Antibody (gantenerumab)(CHA590) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-ACVR2B Reference Antibody (Acceleron patent anti-ActRIIB)synonym : null,productDescription : Anti-ACVR2B Reference Antibody (Acceleron patent anti-ActRIIB)(CHA589) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-Amyloid Beta Reference Antibody (DLX212)synonym : null,productDescription : Anti-Amyloid Beta Reference Antibody (DLX212)(CHA588) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-CK14 Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 52endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-Amyloid Beta Reference Antibody (crenezumab)synonym : null,productDescription : Anti-Amyloid Beta Reference Antibody (crenezumab)(CHA587) is expressed from CHO. The heavy chain type is huIgG4SP, and the light chain…
Product Name : Anti-VEGFR1 / FLT1 Reference Antibody (Abbott patent anti-Flt1)synonym : null,productDescription : Anti-VEGFR1 / FLT1 Reference Antibody (Abbott patent anti-Flt1)(CHA586) is expressed from CHO. The heavy chain type…
Product Name : Anti-Amyloid Beta Reference Antibody (aducanumab)synonym : null,productDescription : Anti-Amyloid Beta Reference Antibody (aducanumab)(CHA583) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-Amyloid Alpha Reference Antibody (birtamimab)synonym : null,productDescription : Anti-Amyloid Alpha Reference Antibody (birtamimab)(CHA582) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-MUC16 Reference Antibody (abagovomab)synonym : null,productDescription : Anti-MUC16 Reference Antibody (abagovomab)(CHA581) is expressed from CHO. The heavy chain type is muIgG1, and the light chain type is…
Product Name : Anti-Integrin a4b7 (ITGA4 & ITGB7) Reference Antibody (abrilumab)synonym : null,productDescription : Anti-Integrin a4b7 (ITGA4 & ITGB7) Reference Antibody (abrilumab)(CHA578) is expressed from CHO. The heavy chain type…
Product Name : Anti-TNFSF4 / OX40L / CD252 Reference Antibody (amlitelimab)synonym : null,productDescription : Anti-TNFSF4 / OX40L / CD252 Reference Antibody (amlitelimab)(CHA579) is expressed from CHO. The heavy chain type…
Product Name : Anti-Siglec-3 / CD33 Reference Antibody (lintuzumAb)synonym : null,productDescription : Anti-Siglec-3 / CD33 Reference Antibody (lintuzumAb)(CHA577) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-TNFRSF5 / CD40 Reference Antibody (selicrelumab)synonym : productDescription : Anti-TNFRSF5 / CD40 Reference Antibody (selicrelumab)(CHA574) is expressed from CHO. The heavy chain type is huIgG2, and the…
Product Name : Anti-TNFRSF10B / TRAILR2 / CD262 Reference Antibody (drozitumab)synonym : null,productDescription : Anti-TNFRSF10B / TRAILR2 / CD262 Reference Antibody (drozitumab)(CHA571) is expressed from CHO. The heavy chain type…
Product Name : Anti-CK10 Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 59endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-CCR5 / CD195 Reference Antibody (leronlimab)synonym : null,productDescription : Anti-CCR5 / CD195 Reference Antibody (leronlimab)(CHA570) is expressed from CHO. The heavy chain type is huIgG4SP, and the…
Product Name : Anti-TLR7 Reference Antibody (U.Tokyo patent anti-TLR7)synonym : null,productDescription : Anti-TLR7 Reference Antibody (U.Tokyo patent anti-TLR7)(CHA569) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-SCN11a / Nav1.9 Reference Antibody (Wuhan U. patent anti-Nav1.9)synonym : null,productDescription : Anti-SCN11a / Nav1.9 Reference Antibody (Wuhan U. patent anti-Nav1.9)(CHA567) is expressed from CHO. The heavy…
Product Name : Anti-CDH11 / Cadherin-11 Reference Antibody (RG6125)synonym : null,productDescription : Anti-CDH11 / Cadherin-11 Reference Antibody (RG6125)(CHA566) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-TREM1 / CD354 Reference Antibody (PY159)synonym : null,productDescription : Anti-TREM1 / CD354 Reference Antibody (PY159)(CHA565) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-GFRA3 Reference Antibody (nadecnemab)synonym : null,productDescription : Anti-GFRA3 Reference Antibody (nadecnemab)(CHA562) is expressed from CHO. The heavy chain type is huIgG4SP, and the light chain type is…
Product Name : Anti-PAR2 Reference Antibody (PAR650097)synonym : null,productDescription : Anti-PAR2 Reference Antibody (PAR650097)(CHA560) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-Complement C5 Reference Antibody (eculizumab)synonym : null,productDescription : Anti-Complement C5 Reference Antibody (eculizumab)(CHA559) is expressed from CHO. The heavy chain type is huIgG2, and the light chain…
Product Name : Anti-MICA Reference Antibody (CLN-619)synonym : null,productDescription : Anti-MICA Reference Antibody (CLN-619)(CHA556) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-MUSK Reference Antibody (Argenx patent anti-MuSK)synonym : null,productDescription : Anti-MUSK Reference Antibody (Argenx patent anti-MuSK)(CHA554) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-CK8 Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 54endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-CD3e Reference Antibody (teplizumab)synonym : null,productDescription : Anti-CD3e Reference Antibody (teplizumab)(CHA553) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-CD59 Reference Antibody ( Mellitus patent anti-CD59)synonym : null,productDescription : Anti-CD59 Reference Antibody ( Mellitus patent anti-CD59)(CHA551) is expressed from CHO. The heavy chain type is muIgG1,…
Product Name : Anti-TSHR Reference Antibody (K1-70)synonym : null,productDescription : Anti-TSHR Reference Antibody (K1-70)(CHA548) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-KLK2 / Kallikrein 2 Reference Antibody (JNJ-69086420)synonym : null,productDescription : Anti-KLK2 / Kallikrein 2 Reference Antibody (JNJ-69086420)(CHA546) is expressed from CHO. The heavy chain type is huIgG1,…
Product Name : Anti-DSG3 Reference Antibody (Forerunner patent anti-DSG3)synonym : null,productDescription : Anti-DSG3 Reference Antibody (Forerunner patent anti-DSG3)(CHA542) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-IL-13 Reference Antibody (tralokinumab)synonym : null,productDescription : Anti-IL-13 Reference Antibody (tralokinumab)(CHA539) is expressed from CHO. The heavy chain type is huIgG4SP, and the light chain type is…
Product Name : Anti-CTLA-8 / IL-17a Reference Antibody (secukinumab)synonym : null,productDescription : Anti-CTLA-8 / IL-17a Reference Antibody (secukinumab)(CHA536) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-HLA-DR Reference Antibody (IMMU-114)synonym : null,productDescription : Anti-HLA-DR Reference Antibody (IMMU-114)(CHA534) is expressed from CHO. The heavy chain type is huIgG4SP, and the light chain type is…
Product Name : Anti-LYPD3 / C4.4A Reference Antibody (lupartumab)synonym : null,productDescription : Anti-LYPD3 / C4.4A Reference Antibody (lupartumab)(CHA533) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-SLAMF6 / CD352 Reference Antibody (SGN-CD352A)synonym : null,productDescription : Anti-SLAMF6 / CD352 Reference Antibody (SGN-CD352A)(CHA532) is expressed from CHO. The heavy chain type is muIgG1, and the…
Product Name : Anti-CK7 Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 51endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-NOTCH3 Reference Antibody (tarextumab)synonym : null,productDescription : Anti-NOTCH3 Reference Antibody (tarextumab)(CHA531) is expressed from CHO. The heavy chain type is huIgG2, and the light chain type is…
Product Name : Anti-SCFR / c-Kit / CD117 Reference Antibody (CDX-0158)synonym : null,productDescription : Anti-SCFR / c-Kit / CD117 Reference Antibody (CDX-0158)(CHA530) is expressed from CHO. The heavy chain type…
Product Name : Anti-TNFSF7 / CD27L / CD70 Reference Antibody (cusatuzumab)synonym : null,productDescription : Anti-TNFSF7 / CD27L / CD70 Reference Antibody (cusatuzumab)(CHA529) is expressed from CHO. The heavy chain type…
Product Name : Anti-EFNA4 Reference Antibody (PF-06647263)synonym : null,productDescription : Anti-EFNA4 Reference Antibody (PF-06647263)(CHA528) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-LAMP1 / CD107a Reference Antibody ( SAR428926)synonym : null,productDescription : Anti-LAMP1 / CD107a Reference Antibody ( SAR428926)(CHA527) is expressed from CHO. The heavy chain type is huIgG1,…
Product Name : Anti-SLC44A4 Reference Antibody (ASG-5ME)synonym : null,productDescription : Anti-SLC44A4 Reference Antibody (ASG-5ME)(CHA525) is expressed from CHO. The heavy chain type is huIgG2, and the light chain type is…
Product Name : Anti-SLITRK6 Reference Antibody (sirtratumab)synonym : null,productDescription : Anti-SLITRK6 Reference Antibody (sirtratumab)(CHA526) is expressed from CHO. The heavy chain type is huIgG2, and the light chain type is…
Product Name : Anti-LRRC15 / LIB Reference Antibody (samrotamab)synonym : null,productDescription : Anti-LRRC15 / LIB Reference Antibody (samrotamab)(CHA524) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti- FcRH5 / IRTA2 / CD307e Reference Antibody (cevostamab)synonym : productDescription : Anti- FcRH5 / IRTA2 / CD307e Reference Antibody (cevostamab)(CHA522) is expressed from CHO. The heavy…
Product Name : Anti-ETBR Reference Antibody (DEDN6526A)synonym : null,productDescription : Anti-ETBR Reference Antibody (DEDN6526A)(CHA523) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-CK (pan) Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 66endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies…
Product Name : Anti-PRLR / Prolactin Receptor Reference Antibody (rolinsatamab)synonym : null,productDescription : Anti-PRLR / Prolactin Receptor Reference Antibody (rolinsatamab)(CHA521) is expressed from CHO. The heavy chain type is huIgG1,…
Product Name : Anti-ALK Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 176 kDaendotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : Humanconcentration : Ready-to-useAntibodies…
Product Name : Anti-GD3 Reference Antibody (ecromeximab)synonym : null,productDescription : Anti-GD3 Reference Antibody (ecromeximab)(CHA519) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-Integrin a11 / ITAG11 Reference Antibody (Scripps patent anti-CD11a)synonym : null,productDescription : Anti-Integrin a11 / ITAG11 Reference Antibody (Scripps patent anti-CD11a)(CHA514) is expressed from CHO. The heavy…
Product Name : Anti-GPC1 / Glypican-1 Reference Antibody (Minomic patent anti-Glypican 1)synonym : null,productDescription : Anti-GPC1 / Glypican-1 Reference Antibody (Minomic patent anti-Glypican 1)(CHA513) is expressed from CHO. The heavy…
Product Name : Anti-CD44v6 Reference Antibody (bivatuzumab)synonym : null,productDescription : Anti-CD44v6 Reference Antibody (bivatuzumab)(CHA511) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-DPEP3 Reference Antibody (tamrintamab)synonym : null,productDescription : Anti-DPEP3 Reference Antibody (tamrintamab)(CHA510) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-MUC1 Reference Antibody (cantuzumab)synonym : null,productDescription : Anti-MUC1 Reference Antibody (cantuzumab)(CHA509) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-c-RET Reference Antibody (Regeneron patent anti-RET)synonym : null,productDescription : Anti-c-RET Reference Antibody (Regeneron patent anti-RET)(CHA503) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-TMEFF1 / Tomoregulin-1 Reference Antibody (Bluefin patent anti-TMEFF1)synonym : null,productDescription : Anti-TMEFF1 / Tomoregulin-1 Reference Antibody (Bluefin patent anti-TMEFF1)(CHA502) is expressed from CHO. The heavy chain type…
Product Name : Anti-Dysadherin Reference Antibody (Centrose patent anti-dysadherin)synonym : null,productDescription : Anti-Dysadherin Reference Antibody (Centrose patent anti-dysadherin)(CHA501) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-CK (LMW) Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 66endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies…
Product Name : Anti-158P1D7 Reference Antibody (Agensys patent anti-158P1D7)synonym : null,productDescription : Anti-158P1D7 Reference Antibody (Agensys patent anti-158P1D7)(CHA500) is expressed from CHO. The heavy chain type is huIgG2, and the…
Product Name : Anti-PTGFRN / CD315 Reference Antibody (AG02-ADC)synonym : null,productDescription : Anti-PTGFRN / CD315 Reference Antibody (AG02-ADC)(CHA499) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-MRC2 / CD280 Reference Antibody (Copenhagen Rigshospitalet patent anti-uPARAP)synonym : null,productDescription : Anti-MRC2 / CD280 Reference Antibody (Copenhagen Rigshospitalet patent anti-uPARAP)(CHA498) is expressed from CHO. The heavy…
Product Name : Anti-Matriptase Reference Antibody (Oxford Bio patent anti-Matriptase)synonym : null,productDescription : Anti-Matriptase Reference Antibody (Oxford Bio patent anti-Matriptase)(CHA497) is expressed from CHO. The heavy chain type is huIgG1,…
Product Name : Anti-DLK1 Reference Antibody (LIV-1205)synonym : null,productDescription : Anti-DLK1 Reference Antibody (LIV-1205)(CHA494) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-TEM1 / Endosialin / CD248 Reference Antibody (ontuxizumab)synonym : null,productDescription : Anti-TEM1 / Endosialin / CD248 Reference Antibody (ontuxizumab)(CHA495) is expressed from CHO. The heavy chain type…
Product Name : Anti-PLAUR / uPAR / CD87 Reference Antibody (ATN-658)synonym : null,productDescription : Anti-PLAUR / uPAR / CD87 Reference Antibody (ATN-658)(CHA493) is expressed from CHO. The heavy chain type…
Product Name : Anti-CD98 Reference Antibody (KHK2898)synonym : null,productDescription : Anti-CD98 Reference Antibody (KHK2898)(CHA492) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-KAAG1 Reference Antibody (ADCT-901)synonym : null,productDescription : Anti-KAAG1 Reference Antibody (ADCT-901)(CHA491) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-Ly6E Reference Antibody (RG7841)synonym : null,productDescription : Anti-Ly6E Reference Antibody (RG7841)(CHA486) is expressed from CHO. The heavy chain type is huIgG2, and the light chain type is…
Product Name : Anti-CK (HMW) Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 66endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies…
Product Name : Anti-CD28 Reference Antibody (lulizumab)synonym : productDescription : Lulizumab is a monovalent Anti-Human CD28 Domain Antibody Antagonist designed for the treatment of autoimmune diseases.molecularWeight : 12.01 kDaendotoxin :…
Product Name : Anti-IL-1b Reference Antibody (canakinumab)synonym : null,productDescription : Anti-IL-1b Reference Antibody (canakinumab)(CHA483) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-TPBG Reference Antibody (PF-06263507)synonym : null,productDescription : Anti-TPBG Reference Antibody (PF-06263507)(CHA478) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-CD163 Reference Antibody (OR2805)synonym : null,productDescription : Anti-CD163 Reference Antibody (OR2805)(CHA479) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-CXC-ELR Reference Antibody (Lilly patent anti-Pan-ELR+)synonym : null,productDescription : Anti-CXC-ELR Reference Antibody (Lilly patent anti-Pan-ELR+)(CHA474) is expressed from CHO. The heavy chain type is huIgG4SP, and the…
Product Name : Anti-HTRA1 Reference Antibody (FHTR2163)synonym : null,productDescription : Anti-HTRA1 Reference Antibody (FHTR2163)(CHA475) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-ANGPTL8 Reference Antibody (Regeneron patent anti-ANGPTL8)synonym : null,productDescription : Anti-ANGPTL8 Reference Antibody (Regeneron patent anti-ANGPTL8)(CHA473) is expressed from CHO. The heavy chain type is huIgG2, and the…
Product Name : Anti-Histone H4 Reference Antibody (Immunomedics patent anti-Histone H4)synonym : null,productDescription : Anti-Histone H4 Reference Antibody (Immunomedics patent anti-Histone H4)(CHA470) is expressed from CHO. The heavy chain type…
Product Name : Anti-RG1 Reference Antibody (19G9)synonym : null,productDescription : Anti-RG1 Reference Antibody (19G9)(CHA472) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-Histone H3 Reference Antibody (Immunomedics patent anti-Histone H3)synonym : null,productDescription : Anti-Histone H3 Reference Antibody (Immunomedics patent anti-Histone H3)(CHA469) is expressed from CHO. The heavy chain type…
Product Name : Anti-Chromogranin Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 51endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-Integrin b7 / ITGB7 Reference Antibody (Genentech patent anti-Integrin β7)synonym : null,productDescription : Anti-Integrin b7 / ITGB7 Reference Antibody (Genentech patent anti-Integrin β7)(CHA465) is expressed from CHO.…
Product Name : Anti-Histone H2B Reference Antibody (Immunomedics patent anti-Histone H2B)synonym : null,productDescription : Anti-Histone H2B Reference Antibody (Immunomedics patent anti-Histone H2B)(CHA468) is expressed from CHO. The heavy chain type…
Product Name : Anti-SCN9a / Nav1.7 Reference Antibody (Duke anti-NAv1.7)synonym : null,productDescription : Anti-SCN9a / Nav1.7 Reference Antibody (Duke anti-NAv1.7)(CHA464) is expressed from CHO. The heavy chain type is huIgG1,…
Product Name : Anti-Polyubiquitin Reference Antibody (Genentech patent anti-Polyubiquitin)synonym : null,productDescription : Anti-Polyubiquitin Reference Antibody (Genentech patent anti-Polyubiquitin)(CHA463) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-ANO1 / TMEM16A Reference Antibody (Novartis patent anti-TMEM16A \t)synonym : null,productDescription : Anti-ANO1 / TMEM16A Reference Antibody (Novartis patent anti-TMEM16A \t)(CHA462) is expressed from CHO. The heavy…
Product Name : Anti-TMEFF2 Reference Antibody (Janssen patent anti-TMEFF2)synonym : null,productDescription : Anti-TMEFF2 Reference Antibody (Janssen patent anti-TMEFF2)(CHA460) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-TIE2 / CD202b Reference Antibody (Regeneron patent anti-TIE-2)synonym : null,productDescription : Anti-TIE2 / CD202b Reference Antibody (Regeneron patent anti-TIE-2)(CHA461) is expressed from CHO. The heavy chain type…
Product Name : Anti-STOP1 Reference Antibody (Genentech patent anti-STOP-1)synonym : null,productDescription : Anti-STOP1 Reference Antibody (Genentech patent anti-STOP-1)(CHA459) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-Albumin Reference Antibody (Numab patent anti-HSA)synonym : null,productDescription : Anti-Albumin Reference Antibody (Numab patent anti-HSA)(CHA458) is expressed from CHO. The antibody type is scFv-Fc（huIgG1）. It has a…
Product Name : Anti-CEACAM5 / CEA / CD66e Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 77endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity :…
Product Name : Anti-GPR73 / PROKR1 Reference Antibody (Multiple seq-one in animal)synonym : null,productDescription : Anti-GPR73 / PROKR1 Reference Antibody (Multiple seq-one in animal)(CHA457) is expressed from CHO. The heavy…
Product Name : Anti-CXCL4 / PF4 Reference Antibody (U.Penn. patent anti-PF4)synonym : null,productDescription : Anti-CXCL4 / PF4 Reference Antibody (U.Penn. patent anti-PF4)(CHA456) is expressed from CHO. The heavy chain type…
Product Name : Anti-Orai1 Reference Antibody (Amgen patent anti-ORAI1)synonym : null,productDescription : Anti-Orai1 Reference Antibody (Amgen patent anti-ORAI1)(CHA453) is expressed from CHO. The heavy chain type is huIgG2, and the…
Product Name : Anti-SERPINE1 Reference Antibody (Sanofi patent anti-PAI-1)synonym : null,productDescription : Anti-SERPINE1 Reference Antibody (Sanofi patent anti-PAI-1)(CHA454) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-KLK5 / Kallikrein 5 Reference Antibody (Genentech patent anti-KLK5)synonym : null,productDescription : Anti-KLK5 / Kallikrein 5 Reference Antibody (Genentech patent anti-KLK5)(CHA452) is expressed from CHO. The heavy…
Product Name : Anti-HGFA Reference Antibody (Genentech patent anti-HGFA\t)synonym : null,productDescription : Anti-HGFA Reference Antibody (Genentech patent anti-HGFA\t)(CHA450) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-TMPRSS2 Reference Antibody (Regeneron patent anti-TMPRSS2 \t)synonym : null,productDescription : Anti-TMPRSS2 Reference Antibody (Regeneron patent anti-TMPRSS2 \t)(CHA448) is expressed from CHO. The heavy chain type is huIgG1,…
Product Name : Anti-TAT226 Reference Antibody (Genentech patent anti-TAT226)synonym : null,productDescription : Anti-TAT226 Reference Antibody (Genentech patent anti-TAT226)(CHA447) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-RGMC / HFE2 Reference Antibody (DISC-0974)synonym : null,productDescription : Anti-RGMC / HFE2 Reference Antibody (DISC-0974)(CHA446) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-Complement Factor P / Properdin Reference Antibody (Novelmed patent anti-Properdin)synonym : null,productDescription : Anti-Complement Factor P / Properdin Reference Antibody (Novelmed patent anti-Properdin)(CHA445) is expressed from CHO.…
Product Name : Anti-PACAP38 Reference Antibody (Lilly patent anti-PACAP)synonym : null,productDescription : Anti-PACAP38 Reference Antibody (Lilly patent anti-PACAP)(CHA444) is expressed from CHO. The heavy chain type is huIgG4SP, and the…
Product Name : Anti-CDX-2 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 34endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-Nogo Receptor / NgR Reference Antibody (Abbott patent anti-NGR)synonym : null,productDescription : Anti-Nogo Receptor / NgR Reference Antibody (Abbott patent anti-NGR)(CHA443) is expressed from CHO. The heavy…
Product Name : Anti-Integrin b2 / ITGB2 / CD18 Reference Antibody (erlizumab)synonym : null,productDescription : Anti-Integrin b2 / ITGB2 / CD18 Reference Antibody (erlizumab)(CHA442) is expressed from CHO. The heavy…
Product Name : Anti-GREM1 / Gremlin Reference Antibody (Regeneron patent anti-GREM1)synonym : null,productDescription : Anti-GREM1 / Gremlin Reference Antibody (Regeneron patent anti-GREM1)(CHA440) is expressed from CHO. The heavy chain type…
Product Name : Anti-GOLM1 Reference Antibody (Cureab patent anti-GP73)synonym : null,productDescription : Anti-GOLM1 Reference Antibody (Cureab patent anti-GP73)(CHA439) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-TPSAB1 Reference Antibody (Genentech patent anti-Tryptase Beta 1)synonym : null,productDescription : Anti-TPSAB1 Reference Antibody (Genentech patent anti-Tryptase Beta 1)(CHA433) is expressed from CHO. The heavy chain type…
Product Name : Anti-GPR44 / PTGDR2 / CD294 Reference Antibody (KHK patent anti-CRTH2)synonym : null,productDescription : Anti-GPR44 / PTGDR2 / CD294 Reference Antibody (KHK patent anti-CRTH2)(CHA437) is expressed from CHO.…
Product Name : Anti-MPL / TPOR / CD110 Reference Antibody (TA136)synonym : null,productDescription : Anti-MPL / TPOR / CD110 Reference Antibody (TA136)(CHA432) is expressed from CHO. The heavy chain type…
Product Name : Anti-CXCR3 / GPR9 / CD183 Reference Antibody (Genzyme patent anti-CXCR3)synonym : null,productDescription : Anti-CXCR3 / GPR9 / CD183 Reference Antibody (Genzyme patent anti-CXCR3)(CHA431) is expressed from CHO.…
Product Name : Anti-Sialyl-Lewis A Reference Antibody (MVT-5873)synonym : null,productDescription : Anti-Sialyl-Lewis A Reference Antibody (MVT-5873)(CHA428) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-vWF Reference Antibody (INSERM patent anti-vWF)synonym : null,productDescription : Anti-vWF Reference Antibody (INSERM patent anti-vWF)(CHA430) is expressed from CHO. The antibody type is VHH-Fc（huIgG1）. It has a…
Product Name : Anti-CD163 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 125endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-PTPRC / CD45 Reference Antibody (apamistamab)synonym : null,productDescription : Anti-PTPRC / CD45 Reference Antibody (apamistamab)(CHA425) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-F9 / Factor IX Reference Antibody (emicizumab)synonym : null,productDescription : Anti-F9 / Factor IX Reference Antibody (emicizumab)(CHA426) is expressed from CHO. The heavy chain type is huIgG4SP,…
Product Name : Anti-NaPi2b / SLC34A2 Reference Antibody (Lifastuzumab)synonym : null,productDescription : Anti-SLC34A2 Reference Antibody (Lifastuzumab)(CHA422) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-Integrin aVb6 (ITGAV & ITGB6) Reference Antibody (STX-100)synonym : null,productDescription : Anti-Integrin aVb6 (ITGAV & ITGB6) Reference Antibody (STX-100)(CHA420) is expressed from CHO. The heavy chain type…
Product Name : Anti-CD74 Reference Antibody (milatuzumab)synonym : null,productDescription : Anti-CD74 Reference Antibody (milatuzumab)(CHA421) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-ILDR2 Reference Antibody (bapotulimab)synonym : null,productDescription : Anti-ILDR2 Reference Antibody (bapotulimab)(CHA414) is expressed from CHO. The heavy chain type is huIgG2, and the light chain type is…
Product Name : Anti-GUCY2C Reference Antibody (indusatumab)synonym : null,productDescription : Anti-GUCY2C Reference Antibody (indusatumab)(CHA418) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-IL-13Ra1 / CD213a1 Reference Antibody (MK-6105)synonym : null,productDescription : Anti-IL-13Ra1 / CD213a1 Reference Antibody (MK-6105)(CHA413) is expressed from CHO. The heavy chain type is huIgG2, and the…
Product Name : Anti-Phosphorylcholine Reference Antibody (ATH3G10)synonym : null,productDescription : Anti-Phosphorylcholine Reference Antibody (ATH3G10)(CHA411) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-Syndecan-1 / CD138 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 32endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration :…
Product Name : Anti-GP6 / Glycoprotein-6 Reference Antibody (glenzocimab)synonym : null,productDescription : Anti-GP6 / Glycoprotein-6 Reference Antibody (glenzocimab)(CHA407) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-CSF2Rb / CD131 Reference Antibody (CSL311)synonym : null,productDescription : Anti-CSF2Rb / CD131 Reference Antibody (CSL311)(CHA404) is expressed from CHO. The heavy chain type is huIgG4, and the…
Product Name : Anti-GFRAL Reference Antibody (NGM120)synonym : null,productDescription : Anti-GFRAL Reference Antibody (NGM120)(CHA405) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-C1q Reference Antibody (ANX005)synonym : productDescription : Anti-C1q Reference Antibody (ANX005)(CHA403) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-Adrenomedullin Reference Antibody (enibarcimab)synonym : null,productDescription : Anti-Adrenomedullin Reference Antibody (enibarcimab)(CHA402) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-INHBA / Activin A Reference Antibody (garetosmab)synonym : null,productDescription : Anti-INHBA / Activin A Reference Antibody (garetosmab)(CHA401) is expressed from CHO. The heavy chain type is huIgG4SP,…
Product Name : Anti-VEGFB Reference Antibody (CSL346)synonym : null,productDescription : Anti-VEGFB Reference Antibody (CSL346)(CHA400) is expressed from CHO. The heavy chain type is huIgG4SP , and the light chain type…
Product Name : Anti-Integrin b1 / ITGB1 / CD29 Reference Antibody (OS2966)synonym : null,productDescription : Anti-Integrin b1 / ITGB1 / CD29 Reference Antibody (OS2966)(CHA396) is expressed from CHO. The heavy…
Product Name : Anti-GPR20 Reference Antibody (DS-6157)synonym : null,productDescription : Anti-GPR20 Reference Antibody (DS-6157)(CHA395) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-CSF3 / G-CSF Reference Antibody (CSL324)synonym : null,productDescription : Anti-CSF3R / G-CSFR Reference Antibody (CSL324)(CHA394) is expressed from CHO. The heavy chain type is huIgG4SP, and the…
Product Name : Anti-Clusterin Reference Antibody (AB-16B5)synonym : null,productDescription : Anti-Clusterin Reference Antibody (AB-16B5)(CHA392) is expressed from CHO. The heavy chain type is huIgG2, and the light chain type is…
Product Name : Anti-IL-3Ra / CD123 Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 43endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration :…
Product Name : Anti-CD14 Reference Antibody (atibuclimab)synonym : null,productDescription : Anti-CD14 Reference Antibody (atibuclimab)(CHA391) is expressed from CHO. The heavy chain type is huIgG4SP, and the light chain type is…
Product Name : Anti-Complement C2 Reference Antibody (ARGX-117)synonym : null,productDescription : Anti-Complement C2 Reference Antibody (ARGX-117)(CHA389) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-Complement C3 Reference Antibody (NGM621)synonym : null,productDescription : Anti-Complement C3 Reference Antibody (NGM621)(CHA390) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-BTN1A1 Reference Antibody (CTX-2026)synonym : null,productDescription : Anti-BTN1A1 Reference Antibody (CTX-2026)(CHA388) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-IL-22Ra Reference Antibody (ARGX-112)synonym : null,productDescription : Anti-IL-22Ra Reference Antibody (ARGX-112)(CHA384) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-IFNAR1 Reference Antibody (anifrolumab)synonym : null,productDescription : Anti-IFNAR1 Reference Antibody (anifrolumab)(CHA383) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-Fucosyl GM1 Reference Antibody (BMS-986012)synonym : null,productDescription : Anti-Fucosyl GM1 Reference Antibody (BMS-986012)(CHA382) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-F12 / Factor XII Reference Antibody (garadacimab)synonym : null,productDescription : Anti-F12 / Factor XII Reference Antibody (garadacimab)(CHA380) is expressed from CHO. The heavy chain type is huIgG4SP,…
Product Name : Anti-FGF23 Reference Antibody (burosumab)synonym : null,productDescription : Anti-FGF23 Reference Antibody (burosumab)(CHA381) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-CALCRL / CGRPR Reference Antibody (erenumab)synonym : null,productDescription : Anti-CALCRL / CGRPR Reference Antibody (erenumab)(CHA379) is expressed from CHO. The heavy chain type is huIgG2, and the…
Product Name : Anti-Endoglin / CD105 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 71endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration :…
Product Name : Anti-TNFRSF13C / BAFFR / CD268 Reference Antibody (ianalumab)synonym : null,productDescription : Anti-TNFRSF13C / BAFFR / CD268 Reference Antibody (ianalumab)(CHA377) is expressed from CHO. The heavy chain type…
Product Name : Anti-CB1 / CNR1 Reference Antibody (GFB-024)synonym : null,productDescription : Anti-CB1 / CNR1 Reference Antibody (GFB-024)(CHA378) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-Melanotransferrin / CD228 Reference Antibody (SC-005)synonym : null,productDescription : Anti-Melanotransferrin / CD228 Reference Antibody (SC-005)(CHA375) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-CD48 Reference Antibody (Regeneron patent anti-CD48)synonym : null,productDescription : Anti-CD48 Reference Antibody (Regeneron patent anti-CD48)(CHA374) is expressed from CHO. The heavy chain type is huIgG2, and the…
Product Name : Anti-Endoglin / CD105 Reference Antibody (carotuximab)synonym : null,productDescription : Anti-Endoglin / CD105 Reference Antibody (carotuximab)(CHA373) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-AMHR2 Reference Antibody (murlentamab)synonym : null,productDescription : Anti-AMHR2 Reference Antibody (murlentamab)(CHA371) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-SLC1A5 / ASCT2 Reference Antibody (idactamab)synonym : null,productDescription : Anti-SLC1A5 / ASCT2 Reference Antibody (idactamab)(CHA372) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-ROBO1 Reference Antibody (Asclepius Technology patent anti-Robo1 CAR)synonym : null,productDescription : Anti-ROBO1 Reference Antibody (Asclepius Technology patent anti-Robo1 CAR)(CHA370) is expressed from CHO. The heavy chain type…
Product Name : Anti-CD6 Reference Antibody (itolizumab)synonym : null,productDescription : Anti-CD6 Reference Antibody (itolizumab)(CHA368) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-FZD10 Reference Antibody (tabituximab)synonym : null,productDescription : Anti-FZD10 Reference Antibody (tabituximab)(CHA366) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-CD99 Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 19endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-CDH6 / K-Cadherin Reference Antibody (DS-6000a)synonym : null,productDescription : Anti-CDH6 / K-Cadherin Reference Antibody (DS-6000a)(CHA364) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-ACTH Mouse mAbsynonym : productDescription : NonemolecularWeight : 29 kDaendotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : Humanconcentration : Ready-to-useAntibodies…
Product Name : Anti-VEGFR1 / FLT1 Reference Antibody (icrucumab)synonym : null,productDescription : Anti-VEGFR1 / FLT1 Reference Antibody (icrucumab)(CHA359) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-AOC3 / VAP1 Reference Antibody (timolumab)synonym : null,productDescription : Anti-AOC3 / VAP1 Reference Antibody (timolumab)(CHA358) is expressed from CHO. The heavy chain type is huIgG4SP, and the…
Product Name : Anti-TNFRSF12A / TWEAKR / CD266 Reference Antibody (enavatuzumab)synonym : null,productDescription : Anti-TNFRSF12A / TWEAKR / CD266 Reference Antibody (enavatuzumab)(CHA356) is expressed from CHO. The heavy chain type…
Product Name : Anti-TYRO3 Reference Antibody (ELB031)synonym : null,productDescription : Anti-TYRO3 Reference Antibody (ELB031)(CHA357) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-TROP2 Reference Antibody (sacituzumab)synonym : null,productDescription : Anti-TROP2 Reference Antibody (sacituzumab)(CHA355) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-TrkA / NTRK1 Reference Antibody (GBR 900)synonym : null,productDescription : Anti-TrkA / NTRK1 Reference Antibody (GBR 900)(CHA354) is expressed from CHO. The heavy chain type is huIgG1,…
Product Name : Anti-TNFRSF10A / TRAILR1 / CD261 Reference Antibody ( mapatumumab)synonym : null,productDescription : Anti-TNFRSF10A / TRAILR1 / CD261 Reference Antibody ( mapatumumab)(CHA352) is expressed from CHO. The heavy…
Product Name : Anti-TIM-3 / HAVCR2 / CD366 Reference Antibody (sabatolimab)synonym : null,productDescription : Anti-TIM-3 / HAVCR2 / CD366 Reference Antibody (sabatolimab)(CHA349) is expressed from CHO. The heavy chain type…
Product Name : Anti-TLR2 / CD282 Reference Antibody (tomaralimab)synonym : null,productDescription : Anti-TLR2 / CD282 Reference Antibody (tomaralimab)(CHA350) is expressed from CHO. The heavy chain type is huIgG4SP, and the…
Product Name : Anti-CD79a Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 25endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-TGFb1 Reference Antibody (M7824)synonym : null,productDescription : Anti-TGFb1 Reference Antibody (M7824)(CHA348) is expressed from CHO. It has a predicted MW of 145.5 kDa.molecularWeight : 178 kDaendotoxin :…
Product Name : Anti-TGFb1 Reference Antibody (SRK181)synonym : null,productDescription : Anti-TGFb1 Reference Antibody (SRK181)(CHA347) is expressed from CHO. The heavy chain type is huIgG4SP, and the light chain type is…
Product Name : Anti-TF / Factor III / Tissue Factor / CD142 Reference Antibody (tisotumab)synonym : productDescription : Anti-TF / Factor III / Tissue Factor / CD142 Reference Antibody (tisotumab)(CHA346)…
Product Name : Anti-Tau Reference Antibody (semorinemab)synonym : null,productDescription : Anti-Tau Reference Antibody (semorinemab)(CHA345) is expressed from CHO. The heavy chain type is huIgG4SP, and the light chain type is…
Product Name : Anti-Tau Reference Antibody (gosuranemab)synonym : null,productDescription : Anti-Tau Reference Antibody (gosuranemab)(CHA344) is expressed from CHO. The heavy chain type is huIgG4SP, and the light chain type is…
Product Name : Anti-Syndecan-1 / CD138 Reference Antibody (indatuximab)synonym : null,productDescription : Anti-Syndecan-1 / CD138 Reference Antibody (indatuximab)(CHA343) is expressed from CHO. It has a predicted MW of 145.5 kDa.molecularWeight…
Product Name : Anti-SIRPg / CD172g Reference Antibody (KWAR23)synonym : productDescription : Anti-SIRPg / CD172g Reference Antibody (KWAR23)(CHA338) is expressed from CHO. The heavy chain type is huIgG4SP, and the…
Product Name : Anti-STAB1 Reference Antibody (bexmarilimab)synonym : null,productDescription : Anti-STAB1 Reference Antibody (bexmarilimab)(CHA341) is expressed from CHO. The heavy chain type is huIgG4SP, and the light chain type is…
Product Name : Anti-SIRPa / CD172a Reference Antibody (Hospital for Sick Children patent anti-SIRPA)synonym : productDescription : Anti-SIRPa / CD172a Reference Antibody (Hospital for Sick Children patent anti-SIRPA)(CHA337) is expressed…
Product Name : Anti-CD74 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 34endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-SEMA4D / CD100 Reference Antibody (pepinemab)synonym : null,productDescription : Anti-SEMA4D / CD100 Reference Antibody (pepinemab)(CHA336) is expressed from CHO. The heavy chain type is huIgG4SP, and the…
Product Name : Anti-SOST / Sclerostin Reference Antibody (romosozumab)synonym : null,productDescription : Anti-SOST / Sclerostin Reference Antibody (romosozumab)(CHA335) is expressed from CHO. The heavy chain type is huIgG2, and the…
Product Name : Anti-RSPO3 Reference Antibody (rosmantuzumab)synonym : null,productDescription : Anti-RSPO3 Reference Antibody (rosmantuzumab)(CHA333) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-SOST / Sclerostin Reference Antibody (setrusumab)synonym : null,productDescription : Anti-SOST / Sclerostin Reference Antibody (setrusumab)(CHA334) is expressed from CHO. The heavy chain type is huIgG2, and the…
Product Name : Anti-RSPO1 Reference Antibody (Oncomed patent anti-RSPO1)synonym : null,productDescription : Anti-RSPO1 Reference Antibody (Oncomed patent anti-RSPO1)(CHA332) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-MSPR / RON / CD136 Reference Antibody (narnatumab)synonym : null,productDescription : Anti-MSPR / RON / CD136 Reference Antibody (narnatumab)(CHA331) is expressed from CHO. The heavy chain type…
Product Name : Anti-TNFSF11 / RANKL / CD254 Reference Antibody (denosumab)synonym : null,productDescription : Anti-TNFSF11 / RANKL / CD254 Reference Antibody (denosumab)(CHA330) is expressed from CHO. The heavy chain type…
Product Name : Anti-AGER / RAGE Reference Antibody (XT-M4)synonym : null,productDescription : Anti-AGER / RAGE Reference Antibody (XT-M4)(CHA329) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-PVRIG Reference Antibody (COM701)synonym : null,productDescription : Anti-PVRIG Reference Antibody (COM701)(CHA328) is expressed from CHO. It has a predicted MW of 145.48 kDa.molecularWeight : 145.48 kDaendotoxin :…
Product Name : Anti-PSCA Reference Antibody (AGS-1C4D4)synonym : null,productDescription : Anti-PSCA Reference Antibody (AGS-1C4D4)(CHA326) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-PVRIG Reference Antibody (GSK4381562)synonym : null,productDescription : Anti-PVRIG Reference Antibody (GSK4381562)(CHA327) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-PRAME Reference Antibody (Eureka patent anti-PRAME)synonym : null,productDescription : Anti-PRAME Reference Antibody (Eureka patent anti-PRAME)(CHA325) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-Transferrin receptor / CD71 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 85endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration…
Product Name : Anti-PLA2G1B Reference Antibody (Diaccurate patent anti-sPLA2-GIB)synonym : null,productDescription : Anti-PLA2G1B Reference Antibody (Diaccurate patent anti-sPLA2-GIB)(CHA323) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-PDGFRB / CD140b Reference Antibody (rinucumab)synonym : null,productDescription : Anti-PDGFRB / CD140b Reference Antibody (rinucumab)(CHA320) is expressed from CHO. The heavy chain type is huIgG4SP, and the…
Product Name : Anti-PGLYRP1 / PGRP-S Reference Antibody (Novo Nordisk patent anti-PGLYRP1)synonym : null,productDescription : Anti-PGLYRP1 / PGRP-S Reference Antibody (Novo Nordisk patent anti-PGLYRP1)(CHA322) is expressed from CHO. The heavy…
Product Name : Anti-PDGFRA / CD140a Reference Antibody (olaratumab)synonym : null,productDescription : Anti-PDGFRA / CD140a Reference Antibody (olaratumab)(CHA319) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-PDGFRA / CD140a Reference Antibody (tovetumab)synonym : null,productDescription : Anti-PDGFRA / CD140a Reference Antibody (tovetumab)(CHA318) is expressed from CHO. The heavy chain type is huIgG2, and the…
Product Name : Anti-PCSK9 Reference Antibody (alirocumab)synonym : null,productDescription : Anti-PCSK9 Reference Antibody (alirocumab)(CHA316) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-PDGFC / VEGFE Reference Antibody (Thrombogenics patent anti-PDGF-C)synonym : null,productDescription : Anti-PDGFC / VEGFE Reference Antibody (Thrombogenics patent anti-PDGF-C)(CHA317) is expressed from CHO. The heavy chain type…
Product Name : Anti-TNFSF4 / OX40L / CD252 Reference Antibody (oxelumab)synonym : null,productDescription : Anti-TNFSF4 / OX40L / CD252 Reference Antibody (oxelumab)(CHA315) is expressed from CHO. The heavy chain type…
Product Name : Anti-CD68 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 37endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-TNFRSF4 / OX40 / CD134 Reference Antibody (tavolixizumab)synonym : null,productDescription : Anti-TNFRSF4 / OX40 / CD134 Reference Antibody (tavolixizumab)(CHA314) is expressed from CHO. It has a predicted…
Product Name : Anti-NRP1 / VEGF165R / CD304 Reference Antibody (vesencumab)synonym : null,productDescription : Anti-NRP1 / VEGF165R / CD304 Reference Antibody (vesencumab)(CHA313) is expressed from CHO. The heavy chain type…
Product Name : Anti-NOTCH1 Reference Antibody (brontictuzumab)synonym : null,productDescription : Anti-NOTCH1 Reference Antibody (brontictuzumab)(CHA312) is expressed from CHO. The heavy chain type is huIgG2, and the light chain type is…
Product Name : Anti-RTN4 / NOGO Reference Antibody (ozanezumab)synonym : null,productDescription : Anti-RTN4 / NOGO Reference Antibody (ozanezumab)(CHA311) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-NKG2A / CD94 Reference Antibody (monalizumab)synonym : null,productDescription : Anti-NKG2A / CD159a Reference Antibody (monalizumab)(CHA310) is expressed from CHO. The heavy chain type is huIgG4SP, and the…
Product Name : Anti-NGF / bNGF Reference Antibody (fulranumab)synonym : null,productDescription : Anti-NGF / bNGF Reference Antibody (fulranumab)(CHA308) is expressed from CHO. The heavy chain type is huIgG2, and the…
Product Name : Anti-NGF / bNGF Reference Antibody (tanezumab)synonym : null,productDescription : Anti-NGF / bNGF Reference Antibody (tanezumab)(CHA309) is expressed from CHO. The heavy chain type is huIgG2, and the…
Product Name : Anti-GDF8 / Myostatin Reference Antibody (trevogrumab)synonym : null,productDescription : Anti-GDF8 / Myostatin Reference Antibody (trevogrumab)(CHA307) is expressed from CHO. The heavy chain type is huIgG4SP, and the…
Product Name : Anti-GDF8 / Myostatin Reference Antibody (landogrozumab)synonym : null,productDescription : Anti-GDF8 / Myostatin Reference Antibody (landogrozumab)(CHA306) is expressed from CHO. The heavy chain type is huIgG4SP, and the…
Product Name : Anti-MUC16 Reference Antibody (sofituzumab)synonym : null,productDescription : Anti-MUC16 Reference Antibody (sofituzumab)(CHA305) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-CD63 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 26endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-MUC16 Reference Antibody (oregovomab)synonym : null,productDescription : Anti-MUC16 Reference Antibody (oregovomab)(CHA304) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-MUC1 Reference Antibody (clivatuzumab)synonym : null,productDescription : Anti-MUC1 Reference Antibody (clivatuzumab)(CHA303) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-MU5AC Reference Antibody (ensituximab)synonym : null,productDescription : Anti-MUC5AC Reference Antibody (ensituximab)(CHA302) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-MIF Reference Antibody (imalumab)synonym : null,productDescription : Anti-MIF Reference Antibody (imalumab)(CHA300) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-MMP9 Reference Antibody (andecaliximab)synonym : null,productDescription : Anti-MMP9 Reference Antibody (andecaliximab)(CHA301) is expressed from CHO. The heavy chain type is huIgG4SP, and the light chain type is…
Product Name : Anti-Mesothelin Reference Antibody (amatuximab)synonym : null,productDescription : Anti-Mesothelin Reference Antibody (amatuximab)(CHA298) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-Mesothelin Reference Antibody (anetumab)synonym : null,productDescription : Anti-Mesothelin Reference Antibody (anetumab)(CHA299) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-MER / MERTK Reference Antibody (RGX-019)synonym : null,productDescription : Anti-MER / MERTK Reference Antibody (RGX-019)(CHA297) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-MASP2 Reference Antibody (narsoplimab)synonym : null,productDescription : Anti-MASP2 Reference Antibody (narsoplimab)(CHA296) is expressed from CHO. The heavy chain type is huIgG4SP, and the light chain type is…
Product Name : Anti-Siglec-4a / MAG Reference Antibody (refanezumab)synonym : null,productDescription : Anti-Siglec-4a / MAG Reference Antibody (refanezumab)(CHA293) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-MAGEA3 Reference Antibody (CT Atlantic patent anti-MAGE-A3)synonym : null,productDescription : Anti-MAGEA3 Reference Antibody (CT Atlantic patent anti-MAGE-A3)(CHA294) is expressed from CHO. The heavy chain type is huIgG1,…
Product Name : Anti-CD61 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 87endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-MADCAM1 Reference Antibody (ontamalimab)synonym : null,productDescription : Anti-MADCAM1 Reference Antibody (ontamalimab)(CHA292) is expressed from CHO. The heavy chain type is huIgG2, and the light chain type is…
Product Name : Anti-LOXL2 Reference Antibody (simtuzumab)synonym : null,productDescription : Anti-LOXL2 Reference Antibody (simtuzumab)(CHA290) is expressed from CHO. The heavy chain type is huIgG4SP, and the light chain type is…
Product Name : Anti-Lewis Y Reference Antibody (MB 311)synonym : null,productDescription : Anti-Lewis Y Reference Antibody (MB 311)(CHA288) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-LILRB2 / ILT4 / CD85d Reference Antibody (JTX-8064)synonym : null,productDescription : Anti-LILRB2 / ILT4 / CD85d Reference Antibody (JTX-8064)(CHA289) is expressed from CHO. It has a predicted…
Product Name : Anti-LEPR / CD295 Reference Antibody (mibavademab)synonym : null,productDescription : Anti-LEPR / CD295 Reference Antibody (mibavademab)(CHA287) is expressed from CHO. The heavy chain type is huIgG4SP, and the…
Product Name : Anti-LAP Reference Antibody (Brigham and Womens anti-LAP)synonym : null,productDescription : Anti-LAP Reference Antibody (Brigham and Womens anti-LAP)(CHA286) is expressed from CHO. The heavy chain type is huIgG2,…
Product Name : Anti-LAG3 / CD223 Reference Antibody (relatlimab)synonym : null,productDescription : Anti-LAG3 / CD223 Reference Antibody (relatlimab)(CHA285) is expressed from CHO. The heavy chain type is huIgG4SP, and the…
Product Name : Anti-KIR2DL1 / CD158a Reference Antibody (Innate patent anti-KIR2DL)synonym : null,productDescription : Anti-KIR2DL1 / CD158a Reference Antibody (Innate patent anti-KIR2DL)(CHA283) is expressed from CHO. The heavy chain type…
Product Name : Anti-IL-9 Reference Antibody (enokizumab)synonym : null,productDescription : Anti-IL-9 Reference Antibody (enokizumab)(CHA282) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-CD57 Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 38endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-CXCL8 / IL-8 Reference Antibody (HuMax-IL8)synonym : null,productDescription : Anti-CXCL8 / IL-8 Reference Antibody (HuMax-IL8)(CHA280) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-IL-5Ra/ CD125 Reference Antibody (benralizumab)synonym : null,productDescription : Anti-IL-5Ra/ CD125 Reference Antibody (benralizumab)(CHA278) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-IL-7Ra / CD127 Reference Antibody (lusvertikimab)synonym : null,productDescription : Anti-IL-7Ra / CD127 Reference Antibody (lusvertikimab)(CHA279) is expressed from CHO. The heavy chain type is huIgG4SP, and the…
Product Name : Anti-IL-5 Reference Antibody (mepolizumab)synonym : null,productDescription : Anti-IL-5 Reference Antibody (mepolizumab)(CHA277) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-IL-4Ra / CD124 Reference Antibody (dupilumab)synonym : null,productDescription : Anti-IL-4Ra / CD124 Reference Antibody (dupilumab)(CHA276) is expressed from CHO. The heavy chain type is huIgG4SP, and the…
Product Name : Anti-IL-4 Reference Antibody (pascolizumab)synonym : null,productDescription : Anti-IL-4 Reference Antibody (pascolizumab)(CHA275) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-IL-33 Reference Antibody (etokimab)synonym : null,productDescription : Anti-IL-33 Reference Antibody (etokimab)(CHA274) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-IL-31Ra Reference Antibody (nemolizumab)synonym : null,productDescription : Anti-IL-31Ra Reference Antibody (nemolizumab)(CHA273) is expressed from CHO. The heavy chain type is huIgG2, and the light chain type is…
Product Name : Anti-IL-2Rb / CD122 Reference Antibody (Singapore ASTR patent anti-IL-2R beta / IL-2R gamma\t)synonym : null,productDescription : Anti-IL-2Rb / CD122 Reference Antibody (Singapore ASTR patent anti-IL-2R beta /…
Product Name : Anti-IL-2Ra / CD25 Reference Antibody (daclizumab)synonym : null,productDescription : Anti-IL-2Ra / CD25 Reference Antibody (daclizumab)(CHA272) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-IL-23a Reference Antibody (tildrakizumab)synonym : null,productDescription : Anti-IL-23a Reference Antibody (tildrakizumab)(CHA270) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-NCAM1 / CD56 Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 95endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration :…
Product Name : Anti-IL-23 Reference Antibody (guselkumab)synonym : null,productDescription : Anti-IL-23 Reference Antibody (guselkumab)(CHA269) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-IL-22 Reference Antibody (fezakinumab)synonym : null,productDescription : Anti-IL-22 Reference Antibody (fezakinumab)(CHA268) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-IL-20 Reference Antibody (fletikumab)synonym : null,productDescription : Anti-IL-20 Reference Antibody (fletikumab)(CHA266) is expressed from CHO. The heavy chain type is huIgG4SP, and the light chain type is…
Product Name : Anti-IL-20Ra Reference Antibody (Cheng Kung U. patent anti-IL-20R1)synonym : null,productDescription : Anti-IL-20Ra Reference Antibody (Cheng Kung U. patent anti-IL-20R1)(CHA267) is expressed from CHO. It has a predicted…
Product Name : Anti-IL-1RL2 / IL-36R Reference Antibody (imsidolimab)synonym : null,productDescription : Anti-IL-1RL2 / IL-36R Reference Antibody (imsidolimab)(CHA264) is expressed from CHO. The heavy chain type is huIgG4SP, and the…
Product Name : Anti-IL-1RL2 / IL-36R Reference Antibody (spesolimab)synonym : null,productDescription : Anti-IL-1RL2 / IL-36R Reference Antibody (spesolimab)(CHA263) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-IL-1R1 / CD121a Reference Antibody (AMG 108)synonym : null,productDescription : Anti-IL-1R1 / CD121a Reference Antibody (AMG 108)(CHA262) is expressed from CHO. The heavy chain type is huIgG2,…
Product Name : Anti-IL-17c Reference Antibody (MOR106)synonym : null,productDescription : Anti-IL-17c Reference Antibody (MOR106)(CHA261) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-IL-13Ra2 / CD213a2 Reference Antibody (Wake Forest U. patent anti-IL-13RA2)synonym : null,productDescription : Anti-IL-13Ra2 / CD213a2 Reference Antibody (Wake Forest U. patent anti-IL-13RA2)(CHA260) is expressed from CHO.…
Product Name : Anti-IL-13 Reference Antibody (anrukinzumab)synonym : null,productDescription : Anti-IL-13 Reference Antibody (anrukinzumab)(CHA259) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-IGF1R / CD221 Reference Antibody (teprotumumab)synonym : null,productDescription : Anti-IGF1R / CD221 Reference Antibody (teprotumumab)(CHA257) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-CD45RO Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 147endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-IGF-1 Reference Antibody (xentuzumab)synonym : null,productDescription : Anti-IGF1 Reference Antibody (xentuzumab)(CHA256) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-IFNa1 Reference Antibody (rontalizumab)synonym : null,productDescription : Anti-IFNa1 Reference Antibody (rontalizumab)(CHA254) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-IFNa1 Reference Antibody (sifalimumab)synonym : null,productDescription : Anti-IFNa1 Reference Antibody (sifalimumab)(CHA255) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-IDO2 Reference Antibody (LIMR patent anti-IDO2)synonym : null,productDescription : Anti-IDO2 Reference Antibody (LIMR patent anti-IDO2)(CHA253) is expressed from CHO. The heavy chain type is huIgG4SP, and the…
Product Name : Anti-ICOS / CD278 Reference Antibody (vopratelimab)synonym : null,productDescription : Anti-ICOS / CD278 Reference Antibody (vopratelimab)(CHA251) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-ICOS / CD278 Reference Antibody (feladilimab)synonym : null,productDescription : Anti-ICOS / CD278 Reference Antibody (feladilimab)(CHA252) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-HGFR / c-Met Reference Antibody (emibetuzumab)synonym : null,productDescription : Anti-HGFR / c-Met Reference Antibody (emibetuzumab)(CHA249) is expressed from CHO. The heavy chain type is huIgG4SP, and the…
Product Name : Anti-HGF / SF Reference Antibody (ficlatuzumab)synonym : null,productDescription : Anti-HGF / SF Reference Antibody (ficlatuzumab)(CHA247) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-HGF / SF Reference Antibody (rilotumumab)synonym : null,productDescription : Anti-HGF / SF Reference Antibody (rilotumumab)(CHA248) is expressed from CHO. The heavy chain type is huIgG2, and the…
Product Name : Anti-CD45R Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 147endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-CD31 Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 83 kDaendotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : Humanconcentration : Ready-to-useAntibodies…
Product Name : Anti-ERBB3 / HER3 Reference Antibody (seribantumab)synonym : null,productDescription : Anti-ERBB3 / HER3 Reference Antibody (seribantumab)(CHA246) is expressed from CHO. The heavy chain type is huIgG2, and the…
Product Name : Anti-HBEGF Reference Antibody (U3-1565)synonym : null,productDescription : Anti-HBEGF Reference Antibody (U3-1565)(CHA244) is expressed from CHO. It has a predicted MW of 145.5 kDa.molecularWeight : 150 kDaendotoxin :…
Product Name : Anti-ERBB3 / HER3 Reference Antibody (patritumab)synonym : null,productDescription : Anti-ERBB3 / HER3 Reference Antibody (patritumab)(CHA245) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-HBEGF Reference Antibody (KHK2866)synonym : null,productDescription : Anti-HBEGF Reference Antibody (KHK2866)(CHA243) is expressed from CHO. It has a predicted MW of 145.5 kDa.molecularWeight : 145 kDaendotoxin :…
Product Name : Anti-Haptoglobin Reference Antibody (KHK patent anti-Haptoglobin)synonym : null,productDescription : Anti-Haptoglobin Reference Antibody (KHK patent anti-Haptoglobin)(CHA242) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-GREM1 / Gremlin Reference Antibody (UCB patent anti-Gremlin-1)synonym : null,productDescription : Anti-GREM1 / Gremlin Reference Antibody (UCB patent anti-Gremlin-1)(CHA239) is expressed from CHO. The heavy chain type…
Product Name : Anti-GPR49 / LGR5 Reference Antibody (petosemtamab)synonym : null,productDescription : Anti-GPR49 / LGR5 Reference Antibody (petosemtamab)(CHA237) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-GPRC5D Reference Antibody (talquetamab)synonym : null,productDescription : Anti-GPRC5D Reference Antibody (talquetamab)(CHA238) is expressed from CHO. The heavy chain type is huIgG4SP, and the light chain type is…
Product Name : Anti-GPR49 / LGR5 Reference Antibody (BNC101)synonym : null,productDescription : Anti-GPR49 / LGR5 Reference Antibody (BNC101)(CHA236) is expressed from CHO. It has a predicted MW of 145.5 kDa.molecularWeight…
Product Name : Anti-GPNMB Reference Antibody (glembatumumab)synonym : null,productDescription : Anti-GPNMB Reference Antibody (glembatumumab)(CHA235) is expressed from CHO. The heavy chain type is huIgG2, and the light chain type is…
Product Name : Anti-PTPRC / CD45Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 147endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies…
Product Name : Anti-CSF2Ra / GM-CSFRa / CD116 Reference Antibody (mavrilimumab)synonym : null,productDescription : Anti-CSF2Ra / GM-CSFRa / CD116 Reference Antibody (mavrilimumab)(CHA232) is expressed from CHO. The heavy chain type…
Product Name : Anti-GPA33 Reference Antibody (KRN330)synonym : null,productDescription : Anti-GPA33 Reference Antibody (KRN330)(CHA234) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-TNFRSF18 / GITR / CD357 Reference Antibody (ragifilimab)synonym : null,productDescription : Anti-TNFRSF18 / GITR / CD357 Reference Antibody (ragifilimab)(CHA230) is expressed from CHO. The heavy chain type…
Product Name : Anti-GIPR Reference Antibody (Amgen patent anti-GIPR)synonym : null,productDescription : Anti-GIPR Reference Antibody (Amgen patent anti-GIPR)(CHA229) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-CSF3R / G-CSFR Reference Antibody (CSL patent anti-G-CSFR)synonym : null,productDescription : Anti-CSF3R / G-CSFR Reference Antibody (CSL patent anti-G-CSFR)(CHA228) is expressed from CHO. The heavy chain type…
Product Name : Anti-GCGR Reference Antibody (volagidemab)synonym : null,productDescription : Anti-GCGR Reference Antibody (volagidemab)(CHA227) is expressed from CHO. The heavy chain type is huIgG2, and the light chain type is…
Product Name : Anti-GCGR Reference Antibody (crotedumab)synonym : null,productDescription : Anti-GCGR Reference Antibody (crotedumab)(CHA226) is expressed from CHO. The heavy chain type is huIgG4SP, and the light chain type is…
Product Name : Anti-FZD7 Reference Antibody (U.Toronto patent anti-FZD7)synonym : null,productDescription : Anti-FZD7 Reference Antibody (U.Toronto patent anti-FZD7)(CHA224) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-FLT3 / CD135 Reference Antibody (IMC-EB10)synonym : null,productDescription : Anti-FLT3 / CD135 Reference Antibody (IMC-EB10)(CHA221) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-Fibronectin Reference Antibody (L19-TNF)synonym : null,productDescription : Anti-Fibronectin Reference Antibody (L19-TNF)(CHA219) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-FGFR4 / CD334 Reference Antibody (U3-1784)synonym : null,productDescription : Anti-FGFR4 / CD334 Reference Antibody (U3-1784)(CHA218) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-CD44 Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 82endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-FGFR3 / CD333 Reference Antibody (LY3076226)synonym : null,productDescription : Anti-FGFR3 / CD333 Reference Antibody (LY3076226)(CHA216) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-FGFR3 / CD333 Reference Antibody (vofatamab)synonym : null,productDescription : Anti-FGFR3 / CD333 Reference Antibody (vofatamab)(CHA217) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-FGF19 Reference Antibody (1A6)synonym : null,productDescription : Anti-FGF19 Reference Antibody (1A6)(CHA214) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-FGF2 Reference Antibody (HuGAL-F2)synonym : null,productDescription : Anti-FGF2 Reference Antibody (HuGAL-F2)(CHA215) is expressed from CHO. The heavy chain type is huIgG2, and the light chain type is…
Product Name : Anti-SLC40A1 Reference Antibody (Amgen patent anti-Ferroportin)synonym : null,productDescription : Anti-SLC40A1 Reference Antibody (Amgen patent anti-Ferroportin)(CHA213) is expressed from CHO. It has a predicted MW of 145.5 kDa.molecularWeight…
Product Name : Anti-SLC40A1 Reference Antibody (LY2928057)synonym : null,productDescription : Anti-SLC40A1 Reference Antibody (LY2928057)(CHA212) is expressed from CHO. It has a predicted MW of 145.5 kDa.molecularWeight : 150 kDaendotoxin :…
Product Name : Anti-EPOR Reference Antibody (Abbott patent anti-EPO Receptor)synonym : null,productDescription : Anti-EPOR Reference Antibody (Abbott patent anti-EPO Receptor)(CHA210) is expressed from CHO. It has a predicted MW of…
Product Name : Anti-FAP Reference Antibody (sibrotuzumab)synonym : null,productDescription : Anti-FAP Reference Antibody (sibrotuzumab)(CHA211) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-CD43 Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 40endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-EphB4 Reference Antibody (VasGene patent anti-EphB4)synonym : null,productDescription : Anti-EphB4 Reference Antibody (VasGene patent anti-EphB4)(CHA207) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-EphB2 Reference Antibody (Genentech patent anti-EphB2)synonym : null,productDescription : Anti-EphB2 Reference Antibody (Genentech patent anti-EphB2)(CHA205) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-EphB4 Reference Antibody (Morphosys patent anti-EphB4)synonym : null,productDescription : Anti-EphB4 Reference Antibody (Morphosys patent anti-EphB4)(CHA206) is expressed from CHO. It has a predicted MW of 145.5 kDa.molecularWeight…
Product Name : Anti-TNFRSF21 / DR6 / CD358 Reference Antibody (Abbvie patent anti-TNFRSF21)synonym : null,productDescription : Anti-TNFRSF21 / DR6 / CD358 Reference Antibody (Abbvie patent anti-TNFRSF21)(CHA201) is expressed from CHO.…
Product Name : Anti-EpCAM / TROP1 / CD326 Reference Antibody (citatuzumab)synonym : null,productDescription : Anti-EpCAM / TROP1 / CD326 Reference Antibody (citatuzumab)(CHA203) is expressed from CHO. The heavy chain type…
Product Name : Anti-DLL4 Reference Antibody (navicixizumab)synonym : null,productDescription : Anti-DLL4 Reference Antibody (navicixizumab)(CHA199) is expressed from CHO. The heavy chain type is huIgG2, and the light chain type is…
Product Name : Anti-DLL4 Reference Antibody (demcizumab)synonym : null,productDescription : Anti-DLL4 Reference Antibody (demcizumab)(CHA198) is expressed from CHO. The heavy chain type is huIgG2, and the light chain type is…
Product Name : Anti-CLEC7A Reference Antibody (Baylor patent anti-Dectin-1)synonym : null,productDescription : Anti-CLEC7A Reference Antibody (Baylor patent anti-Dectin-1)(CHA196) is expressed from CHO. The heavy chain type is huIgG4SP, and the…
Product Name : Anti-DKK1 Reference Antibody (BHQ-880)synonym : null,productDescription : Anti-DKK1 Reference Antibody (BHQ-880)(CHA197) is expressed from CHO. It has a predicted MW of 145.5 kDa.molecularWeight : 142.96 kDaendotoxin :…
Product Name : Anti-DC-SIGN / CD209 Reference Antibody (INSERM patent anti-DC-SIGN)synonym : null,productDescription : Anti-DC-SIGN / CD209 Reference Antibody (INSERM patent anti-DC-SIGN)(CHA195) is expressed from CHO. The heavy chain type…
Product Name : Anti-CD38 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 34endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-CXCR5 / CD185 Reference Antibody (SAR113244)synonym : null,productDescription : Anti-CXCR5 / CD185 Reference Antibody (SAR113244)(CHA194) is expressed from CHO. The heavy chain type is huIgG4SP, and the…
Product Name : Anti-CXCL9 Reference Antibody (Novimmune patent anti-CXCL9)synonym : null,productDescription : Anti-CXCL9 Reference Antibody (Novimmune patent anti-CXCL9)(CHA193) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-CXADR Reference Antibody (Med. Bio. Labs patent anti-CXADR)synonym : null,productDescription : Anti-CXADR Reference Antibody (Med. Bio. Labs patent anti-CXADR)(CHA190) is expressed from CHO. The heavy chain type…
Product Name : Anti-CXCL10 / IP-10 Reference Antibody (eldelumab)synonym : null,productDescription : Anti-CXCL10 / IP-10 Reference Antibody (eldelumab)(CHA191) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-CRTAM / CD355 Reference Antibody (Oxford Bio patent anti-CRTAM)synonym : null,productDescription : Anti-CRTAM / CD355 Reference Antibody (Oxford Bio patent anti-CRTAM)(CHA186) is expressed from CHO. The heavy…
Product Name : Anti-CSF1R / M-CSFR / CD115 Reference Antibody (cabiralizumab)synonym : null,productDescription : Anti-CSF1R / M-CSFR / CD115 Reference Antibody (cabiralizumab)(CHA188) is expressed from CHO. The heavy chain type…
Product Name : Anti-CLEC14A Reference Antibody (Scripps Korea patent anti-CLEC14A)synonym : null,productDescription : Anti-CLEC14A Reference Antibody (Scripps Korea patent anti-CLEC14A)(CHA184) is expressed from CHO. The heavy chain type is huIgG1,…
Product Name : Anti-CLDN6 Reference Antibody (IMAB027)synonym : null,productDescription : Anti-CLDN6 Reference Antibody (IMAB027)(CHA182) is expressed from CHO. It has a predicted MW of 145.5 kDa.molecularWeight : 144.42 kDaendotoxin :…
Product Name : Anti-CLEC12A / CD371 Reference Antibody (tepoditamab)synonym : null,productDescription : Anti-CLEC12A / CD371 Reference Antibody (tepoditamab)(CHA183) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-CLDN18.2 Reference Antibody (zolbetuximab)synonym : null,productDescription : Anti-CLDN18.2 Reference Antibody (zolbetuximab)(CHA181) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-CD35 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 224endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-DCBLD2 / ESDN Reference Antibody (FA19-1)synonym : null,productDescription : Anti-DCBLD2 / ESDN Reference Antibody (FA19-1)(CHA180) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-CCL20 Reference Antibody (GSK3050002)synonym : null,productDescription : Anti-CCL20 Reference Antibody (GSK3050002)(CHA179) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-CEACAM6 / CD66c Reference Antibody (NEO-201)synonym : null,productDescription : Anti-CEACAM6 / CD66c Reference Antibody (NEO-201)(CHA177) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-CHI3L1 Reference Antibody (Brown U. patent anti-CHI3L1)synonym : null,productDescription : Anti-CHI3L1 Reference Antibody (Brown U. patent anti-CHI3L1)(CHA178) is expressed from CHO. The heavy chain type is huIgG1,…
Product Name : Anti-CEACAM1 / CD66a Reference Antibody (CM-24)synonym : null,productDescription : Anti-CEACAM1 / CD66a Reference Antibody (CM-24)(CHA175) is expressed from CHO. It has a predicted MW of 145.5 kDa.molecularWeight…
Product Name : Anti-CEACAM5 / CEA / CD66e Reference Antibody (labetuzumab)synonym : null,productDescription : Anti-CEACAM5 / CEA / CD66e Reference Antibody (labetuzumab)(CHA174) is expressed from CHO. The heavy chain type…
Product Name : Anti-CDCP1 / CD318 Reference Antibody (U.California patent anti-CDCP1)synonym : null,productDescription : Anti-CDCP1 / CD318 Reference Antibody (U.California patent anti-CDCP1)(CHA172) is expressed from CHO. The heavy chain type…
Product Name : Anti-CD79b Reference Antibody (polatuzumab)synonym : null,productDescription : Anti-CD79b Reference Antibody (polatuzumab)(CHA171) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-CD69 Reference Antibody (Genefrontier patent anti-CD69)synonym : null,productDescription : Anti-CD69 Reference Antibody (Genefrontier patent anti-CD69)(CHA168) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-NCAM1 / CD56 Reference Antibody (lorvotuzumab)synonym : null,productDescription : Anti-NCAM1 / CD56 Reference Antibody (lorvotuzumab)(CHA167) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-CD52 Reference Antibody (alemtuzumab)synonym : null,productDescription : Anti-CD52 Reference Antibody (alemtuzumab)(CHA166) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-CD34 Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 41endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-CD47 Reference Antibody (CC-90002)synonym : null,productDescription : Anti-CD47 Reference Antibody (CC-90002)(CHA165) is expressed from CHO. It has a predicted MW of 145.5 kDa.molecularWeight : 145 kDaendotoxin :…
Product Name : Anti-CD47 Reference Antibody (magrolimab)synonym : null,productDescription : Anti-CD47 Reference Antibody (magrolimab)(CHA164) is expressed from CHO. The heavy chain type is huIgG4SP, and the light chain type is…
Product Name : Anti-CD46 Reference Antibody (FOR46)synonym : null,productDescription : Anti-CD46 Reference Antibody (FOR46)(CHA163) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-TNFRSF5 / CD40 Reference Antibody (dacetuzumab)synonym : null,productDescription : Anti-TNFRSF5 / CD40 Reference Antibody (dacetuzumab)(CHA162) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-TNFRSF5 / CD40 Reference Antibody (sotigalimab)synonym : null,productDescription : Anti-TNFRSF5 / CD40 Reference Antibody (sotigalimab)(CHA161) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-ENTPD1 / CD39 Reference Antibody (TTX-030)synonym : null,productDescription : Anti-ENTPD1 / CD39 Reference Antibody (TTX-030)(CHA159) is expressed from CHO. The heavy chain type is huIgG4SP, and the…
Product Name : Anti-TNFRSF5 / CD40 Reference Antibody (bleselumab)synonym : null,productDescription : Anti-TNFRSF5 / CD40 Reference Antibody (bleselumab)(CHA160) is expressed from CHO. The heavy chain type is huIgG4SP, and the…
Product Name : Anti-FcgR2a / CD32a Reference Antibody (VIB9600)synonym : null,productDescription : Anti-FcgR2a / CD32a Reference Antibody (VIB9600)(CHA157) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-IL-2Ra / CD25 Reference Antibody (basiliximab)synonym : null,productDescription : Anti-IL-2Ra / CD25 Reference Antibody (basiliximab)(CHA151) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-TNFRSF17 / BCMA / CD269 Reference Antibody (belantamab)synonym : null,productDescription : Anti-TNFRSF17 / BCMA / CD269 Reference Antibody (belantamab)(CHA154) is expressed from CHO. The heavy chain type…
Product Name : Anti-OX2R / CD200R1 Reference Antibody (Janssen patent anti-CD200R1)synonym : null,productDescription : Anti-OX2R / CD200R1 Reference Antibody (Janssen patent anti-CD200R1)(CHA149) is expressed from CHO. It has a predicted…
Product Name : Anti-TNFRSF8 / CD30 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 64endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration :…
Product Name : Anti-CD200 Reference Antibody (samalizumab)synonym : null,productDescription : Anti-CD200 Reference Antibody (samalizumab)(CHA148) is expressed from CHO. The heavy chain type is huIgG2, and the light chain type is…
Product Name : Anti-PROM1 / CD133 Reference Antibody (Forerunner patent anti-Prominin-1)synonym : null,productDescription : Anti-PROM1 / CD133 Reference Antibody (Forerunner patent anti-Prominin-1)(CHA145) is expressed from CHO. The heavy chain type…
Product Name : Anti-IL-3Ra / CD123 Reference Antibody (talacotuzumab)synonym : null,productDescription : Anti-IL-3Ra / CD123 Reference Antibody (talacotuzumab)(CHA143) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-IL-3Ra / CD123 Reference Antibody (SNG-CD123A)synonym : null,productDescription : Anti-IL-3Ra / CD123 Reference Antibody (SNG-CD123A)(CHA142) is expressed from CHO. It has a predicted MW of 146.04 kDa.molecularWeight…
Product Name : Anti-SCFR / c-Kit / CD117 Reference Antibody (LOP628)synonym : null,productDescription : Anti-SCFR / c-Kit / CD117 Reference Antibody (LOP628)(CHA141) is expressed from CHO. It has a predicted…
Product Name : Anti-CCR7 / CD197 Reference Antibody (R707)synonym : null,productDescription : Anti-CCR7 / CD197 Reference Antibody (R707)(CHA140) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-CCR4 / CD194 Reference Antibody (mogamulizumab)synonym : null,productDescription : Anti-CCR4 / CD194 Reference Antibody (mogamulizumab)(CHA139) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-CCR2 / CD192 Reference Antibody (plozalizumab)synonym : null,productDescription : Anti-CCR2 / CD192 Reference Antibody (plozalizumab)(CHA138) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-CCL5 / RANTES Reference Antibody (VLST-002)synonym : null,productDescription : Anti-CCL5 / RANTES Reference Antibody (VLST-002)(CHA137) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-FceR2 / CD23 Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 36endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration :…
Product Name : Anti-CTSS / Cathepsin S Reference Antibody (Fsn0503h)synonym : null,productDescription : Anti-CTSS / Cathepsin S Reference Antibody (Fsn0503h)(CHA136) is expressed from CHO. The heavy chain type is huIgG1,…
Product Name : Anti-CA9 / CAIX Reference Antibody (girentuximab)synonym : productDescription : Anti-CA9 / Carbonic anhydrase 9 Reference Antibody (girentuximab)(CHA134) is expressed from CHO. The heavy chain type is huIgG1,…
Product Name : Anti-CDH6 / K-Cadherin Reference Antibody (HKT288)synonym : null,productDescription : Anti-CDH6 / K-Cadherin Reference Antibody (HKT288)(CHA132) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-Complement C5aR1 Reference Antibody (G2_anti-C5aR)synonym : null,productDescription : Anti-Complement C5aR1 Reference Antibody (G2_anti-C5aR)(CHA130) is expressed from CHO. The heavy chain type is huIgG4SP, and the light chain…
Product Name : Anti-C1s Reference Antibody (sutimlimab)synonym : null,productDescription : Anti-C1s Reference Antibody (sutimlimab)(CHA129) is expressed from CHO. The heavy chain type is huIgG4SP, and the light chain type is…
Product Name : Anti-BST2 / CD317 Reference Antibody (XmAb 5592)synonym : null,productDescription : Anti-BST2 / CD317 Reference Antibody (XmAb 5592)(CHA128) is expressed from CHO. The heavy chain type is huIgG1,…
Product Name : Anti-Klotho Beta Reference Antibody (NGM313)synonym : null,productDescription : Anti-Klotho Beta Reference Antibody (NGM313)(CHA127) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-Klotho Beta Reference Antibody (RG7992)synonym : null,productDescription : Anti-Klotho Beta Reference Antibody (RG7992)(CHA126) is expressed from CHO. It has a predicted MW of 145.24 kDa.molecularWeight : 145…
Product Name : Anti-Bcl-2 Reference Antibody (U.Toronto patent anti-Bax)synonym : null,productDescription : Anti-Bcl-2 Reference Antibody (U.Toronto patent anti-Bax)(CHA124) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-TNFSF13B / BAFF / CD257 Reference Antibody (belimumab)synonym : null,productDescription : Anti-TNFSF13B / BAFF / CD257 Reference Antibody (belimumab)(CHA123) is expressed from CHO. The heavy chain type…
Product Name : Anti-CD21 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 113endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-B7-H6 / NCR3LG1 Reference Antibody (Dartmouth patent anti-B7-H6)synonym : null,productDescription : Anti-B7-H6 / NCR3LG1 Reference Antibody (Dartmouth patent anti-B7-H6)(CHA121) is expressed from CHO. It has a predicted…
Product Name : Anti-B7-H5 / VISTA Reference Antibody (onvatilimab)synonym : null,productDescription : Anti-B7-H5 / VISTA Reference Antibody (onvatilimab)(CHA120) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-TNFSF13 / APRIL / CD256 Reference Antibody (BION-1301)synonym : null,productDescription : Anti-TNFSF13 / APRIL / CD256 Reference Antibody (BION-1301)(CHA118) is expressed from CHO. The heavy chain type…
Product Name : Anti-B7-H3 / CD276 Reference Antibody (enoblituzumab)synonym : null,productDescription : Anti-B7-H3 / CD276 Reference Antibody (enoblituzumab)(CHA119) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-Serum Amyloid P / SAP Reference Antibody (dezamizumab)synonym : null,productDescription : Anti-Serum Amyloid P / SAP Reference Antibody (dezamizumab)(CHA117) is expressed from CHO. The heavy chain type…
Product Name : Anti-ANGPT2 Reference Antibody (nesvacumab)synonym : null,productDescription : Anti-ANGPT2 Reference Antibody (nesvacumab)(CHA115) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-ANGPTL3 Reference Antibody (evinacumab)synonym : null,productDescription : Anti-ANGPTL3 Reference Antibody (evinacumab)(CHA116) is expressed from CHO. The heavy chain type is huIgG4SP, and the light chain type is…
Product Name : Anti-Alpha-synuclein Reference Antibody (prasinezumab)synonym : null,productDescription : Anti-Alpha-synuclein Reference Antibody (prasinezumab)(CHA113) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-ACVRL1 / ALK-1 Reference Antibody (ascrinvacumab)synonym : null,productDescription : Anti-ACVRL1 / ALK-1 Reference Antibody (ascrinvacumab)(CHA111) is expressed from CHO. The heavy chain type is huIgG2, and the…
Product Name : Anti-Alpha-synuclein Reference Antibody (cinpanemab)synonym : null,productDescription : Anti-Alpha-synuclein Reference Antibody (cinpanemab)(CHA112) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-FcgR3a / CD16a Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 29endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration :…
Product Name : Anti-ALCAM / CD166 Reference Antibody (AT002)synonym : null,productDescription : Anti-ALCAM / CD166 Reference Antibody (AT002)(CHA110) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-CD19 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 61 kDaendotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : Humanconcentration : Ready-to-useAntibodies…
Product Name : Anti-ALCAM / CD166 Reference Antibody (praluzatamab)synonym : null,productDescription : Anti-ALCAM / CD166 Reference Antibody (praluzatamab)(CHA109) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-ACVR2A Reference Antibody (Ab-14E1)synonym : null,productDescription : Anti-ACVR2A Reference Antibody (Ab-14E1)(CHA106) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-ACVR2B Reference Antibody (bimagrumab)synonym : null,productDescription : Anti-ACVR2B Reference Antibody (bimagrumab)(CHA108) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-ACVR1 / ALK-2 Reference Antibody (DS-6016a)synonym : null,productDescription : Anti-ACVR1 / ALK-2 Reference Antibody (DS-6016a)(CHA105) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-TNFRSF9 / 4-1BB / CD137 Reference Antibody (urelumab)synonym : null,productDescription : Anti-TNFRSF9 / 4-1BB / CD137 Reference Antibody (urelumab)(CHA103) is expressed from CHO. The heavy chain type…
Product Name : Anti-TNFSF9 / 4-1BBL Reference Antibody (Abbvie patent anti-TNFSF9)synonym : null,productDescription : Anti-TNFSF9 / 4-1BBL Reference Antibody (Abbvie patent anti-TNFSF9)(CHA104) is expressed from CHO. The heavy chain type…
Product Name : Anti-TNFRSF9 / 4-1BB / CD137 Reference Antibody (utomilumab)synonym : null,productDescription : Anti-TNFRSF9 / 4-1BB / CD137 Reference Antibody (utomilumab)(CHA102) is expressed from CHO. The heavy chain type…
Product Name : Anti-VEGFR2 / KDR / CD309 Reference Antibody (ramucirumab)synonym : null,productDescription : Anti-VEGFR2 / KDR / CD309 Reference Antibody (ramucirumab)(CHA100) is expressed from CHO. The heavy chain type…
Product Name : Anti-VEGFA Reference Antibody (bevacizumab)synonym : null,productDescription : Anti-VEGFA Reference Antibody (bevacizumab)(CHA099) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-CD14 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 40endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-TNFSF2 / TNFa Reference Antibody (infliximab)synonym : null,productDescription : Anti-TNFSF2 / TNFa Reference Antibody (infliximab)(CHA098) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-TNFSF2 / TNFa Reference Antibody (adalimumab)synonym : null,productDescription : Anti-TNFSF2 / TNFa Reference Antibody (adalimumab)(CHA097) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-TIGIT Reference Antibody (tiragolumab)synonym : null,productDescription : Anti-TIGIT Reference Antibody (tiragolumab)(CHA096) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-SLAMF7 / CS1 Reference Antibody (elotuzumab)synonym : null,productDescription : Anti-SLAMF7 / CS1 Reference Antibody (elotuzumab)(CHA095) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-Siglec-8 Reference Antibody (lirentelimab)synonym : null,productDescription : Anti-Siglec-8 Reference Antibody (lirentelimab)(CHA094) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-Siglec-15 / CD33L3 Reference Antibody (NC318)synonym : null,productDescription : Anti-Siglec-15 / CD33L3 Reference Antibody (NC318)(CHA093) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-ROR1 Reference Antibody (zilovertamab)synonym : null,productDescription : Anti-ROR1 Reference Antibody (zilovertamab)(CHA092) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-RGMA Reference Antibody (elezanumab)synonym : null,productDescription : Anti-RGMA Reference Antibody (elezanumab)(CHA091) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-PSGL1 / CD162 Reference Antibody (neihulizumab)synonym : productDescription : Anti-PSGL1 / CD162 Reference Antibody (neihulizumab)(CHA089) is expressed from CHO. The heavy chain type is huIgG4SP, and the…
Product Name : Anti-FOLH1 / PSMA Reference Antibody (rosopatamab)synonym : null,productDescription : Anti-FOLH1 / PSMA Reference Antibody (rosopatamab)(CHA090) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-CD13 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 110endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-P-Selectin / CD62p Reference Antibody (inclacumab)synonym : null,productDescription : Anti-P-Selectin / CD62p Reference Antibody (inclacumab)(CHA087) is expressed from CHO. The heavy chain type is huIgG4SP, and the…
Product Name : Anti-P-Selectin / CD62p Reference Antibody (crizanlizumab)synonym : null,productDescription : Anti-P-Selectin / CD62p Reference Antibody (crizanlizumab)(CHA088) is expressed from CHO. The heavy chain type is huIgG2, and the…
Product Name : Anti-PMEL Reference Antibody (Novartis patent anti-PMEL17)synonym : null,productDescription : Anti-PMEL Reference Antibody (Novartis patent anti-PMEL17)(CHA086) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-B7-H1 / PD-L1 / CD274 Reference Antibody (durvalumab)synonym : null,productDescription : Anti-B7-H1 / PD-L1 / CD274 Reference Antibody (durvalumab)(CHA084) is expressed from CHO. The heavy chain type…
Product Name : Anti-PMEL Reference Antibody (Genentech anti-PMEL17)synonym : null,productDescription : Anti-PMEL Reference Antibody (Genentech anti-PMEL17)(CHA085) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-B7-H1 / PD-L1 / CD274 Reference Antibody (atezolizumab)synonym : null,productDescription : Anti-B7-H1 / PD-L1 / CD274 Reference Antibody (atezolizumab)(CHA083) is expressed from CHO. The heavy chain type…
Product Name : Anti-B7-H1 / PD-L1 / CD274 Reference Antibody (MDX-1105)synonym : null,productDescription : Anti-B7-H1 / PD-L1 / CD274 Reference Antibody (MDX-1105)(CHA082) is expressed from CHO. The heavy chain type…
Product Name : Anti-PDGFB Reference Antibody (MOR-8457)synonym : null,productDescription : Anti-PDGFB Reference Antibody (MOR-8457)(CHA080) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-B7-H1 / PD-L1 / CD274 Reference Antibody (avelumab)synonym : null,productDescription : Anti-B7-H1 / PD-L1 / CD274 Reference Antibody (avelumab)(CHA081) is expressed from CHO. The heavy chain type…
Product Name : Anti-PDCD1 / PD-1 / CD279 Reference Antibody (nivolumab)synonym : null,productDescription : Anti-PDCD1 / PD-1 / CD279 Reference Antibody (nivolumab)(CHA079) is expressed from CHO. The heavy chain type…
Product Name : Anti-PDCD1 / PD-1 / CD279 Reference Antibody (pembrolizumab)synonym : null,productDescription : Anti-PDCD1 / PD-1 / CD279 Reference Antibody (pembrolizumab)(CHA078) is expressed from CHO. The heavy chain type…
Product Name : Anti-Neprilysin / CD10 Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 86endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration :…
Product Name : Anti-PDCD1 / PD-1 / CD279 Reference Antibody (spartalizumab)synonym : null,productDescription : Anti-PDCD1 / PD-1 / CD279 Reference Antibody (spartalizumab)(CHA076) is expressed from CHO. The heavy chain type…
Product Name : Anti-PDCD1 / PD-1 / CD279 Reference Antibody (camrelizumab)synonym : null,productDescription : Anti-PDCD1 / PD-1 / CD279 Reference Antibody (camrelizumab)(CHA077) is expressed from CHO. The heavy chain type…
Product Name : Anti-NT5E / CD73 Reference Antibody (oleclumab)synonym : null,productDescription : Anti-NT5E / CD73 Reference Antibody (oleclumab)(CHA075) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-NKG2D / CD314 Reference Antibody (tesnatilimab)synonym : null,productDescription : Anti-NKG2D / CD314 Reference Antibody (tesnatilimab)(CHA074) is expressed from CHO. The heavy chain type is huIgG4SP, and the…
Product Name : Anti-Nectin-4 Reference Antibody (enfortumab)synonym : null,productDescription : Anti-Nectin-4 Reference Antibody (enfortumab)(CHA073) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-CSF1 / M-CSF Reference Antibody (lacnotuzumab)synonym : null,productDescription : Anti-CSF1 / M-CSF Reference Antibody (lacnotuzumab)(CHA072) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-LILRB4 / ILT3 / CD85k Reference Antibody (U.Texas patent anti-LILRB4)synonym : null,productDescription : Anti-LILRB4 / ILT3 / CD85k Reference Antibody (U.Texas patent anti-LILRB4)(CHA071) is expressed from CHO.…
Product Name : Anti-LILRB4 / ILT3 / CD85k Reference Antibody (Merck patent anti-ILT3 complex)synonym : null,productDescription : Anti-LILRB4 / ILT3 / CD85k Reference Antibody (Merck patent anti-ILT3 complex)(CHA070) is expressed…
Product Name : Anti-LIF Reference Antibody (MSC-1)synonym : null,productDescription : Anti-LIF Reference Antibody (MSC-1)(CHA069) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-CD8 Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 26endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-KIR3DL2 / CD158k Reference Antibody (lacutamab)synonym : null,productDescription : Anti-KIR3DL2 / CD158k Reference Antibody (lacutamab)(CHA068) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-KIR Reference Antibody (lirilumab)synonym : null,productDescription : Anti-KIR Reference Antibody (lirilumab)(CHA067) is expressed from CHO. The heavy chain type is huIgG4SP, and the light chain type is…
Product Name : Anti-IL-6Ra / CD126 Reference Antibody (tocilizumab)synonym : null,productDescription : Anti-IL-6Ra / CD126 Reference Antibody (tocilizumab)(CHA065) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-IL-6Ra / CD126 Reference Antibody (sarilumab)synonym : null,productDescription : Anti-IL-6Ra / CD126 Reference Antibody (sarilumab)(CHA064) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-IL-6Ra / CD126 Reference Antibody (vobarilizumab)synonym : null,productDescription : Anti-IL-6Ra / CD126 Reference Antibody (vobarilizumab)(CHA063) is expressed from CHO. It has a predicted MW of 146.32 kDa.molecularWeight…
Product Name : Anti-IL-6 / IFNb2 Reference Antibody (clazakizumab)synonym : null,productDescription : Anti-IL-6 / IFNb2 Reference Antibody (clazakizumab)(CHA062) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-IL-1RAP / IL-1R3 Reference Antibody (nidanilimab)synonym : null,productDescription : Anti-IL-1RAP / IL-1R3 Reference Antibody (nidanilimab)(CHA059) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-IL-21 Reference Antibody (Lilly patent anti-IL-21)synonym : null,productDescription : Anti-IL-21 Reference Antibody (Lilly patent anti-IL-21)(CHA060) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-IL-18 Reference Antibody (GSK 1070806)synonym : null,productDescription : Anti-IL-18 Reference Antibody (GSK 1070806)(CHA058) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-IL-17Ra / CD217 Reference Antibody (brodalumab)synonym : null,productDescription : Anti-IL-17Ra / CD217 Reference Antibody (brodalumab)(CHA057) is expressed from CHO. The heavy chain type is huIgG2, and the…
Product Name : Anti-IL-15 Reference Antibody (ordesekimab)synonym : null,productDescription : Anti-IL-15 Reference Antibody (ordesekimab)(CHA055) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-CD7 Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 25endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-ERBB2 / HER2 / CD340 Reference Antibody (pertuzumab)synonym : null,productDescription : Anti-ERBB2 / HER2 / CD340 Reference Antibody (pertuzumab)(CHA054) is expressed from CHO. The heavy chain type…
Product Name : Anti-ERBB2 / HER2 / CD340 Reference Antibody (trastuzumab)synonym : null,productDescription : Anti-ERBB2 / HER2 / CD340 Reference Antibody (trastuzumab)(CHA053) is expressed from CHO. It has a predicted…
Product Name : Anti-ERBB2 / HER2 / CD340 Reference Antibody (zanidatamab)synonym : null,productDescription : Anti-ERBB2 / HER2 / CD340 Reference Antibody (zanidatamab)(CHA052) is expressed from CHO. The heavy chain type…
Product Name : Anti-ERBB2 / HER2 / CD340 Reference Antibody (disitamab)synonym : null,productDescription : Anti-ERBB2 / HER2 / CD340 Reference Antibody (disitamab)(CHA051) is expressed from CHO. The heavy chain type…
Product Name : Anti-GPC3 / Glypican-3 Reference Antibody (codrituzumab)synonym : null,productDescription : Anti-GPC3 / Glypican-3 Reference Antibody (codrituzumab)(CHA050) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-FOLR1 / FRA Reference Antibody (mirvetuximab)synonym : null,productDescription : Anti-FOLR1 Reference Antibody (mirvetuximab)(CHA049) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-FOLR1 / FRA Reference Antibody (farletuzumab)synonym : null,productDescription : Anti-FOLR1 Reference Antibody (farletuzumab)(CHA048) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-FGFR2 / CD332 Reference Antibody (aprutumab)synonym : null,productDescription : Anti-FGFR2 / CD332 Reference Antibody (aprutumab)(CHA047) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-FGFR2 / CD332 Reference Antibody (bemarituzumab)synonym : null,productDescription : Anti-FGFR2 / CD332 Reference Antibody (bemarituzumab)(CHA046) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-CD5 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 55endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-FcRn (FCGRT & B2M) Reference Antibody (rozanolixizumab)synonym : null,productDescription : Anti-FcRn (FCGRT & B2M) Reference Antibody (rozanolixizumab)(CHA045) is expressed from CHO. The heavy chain type is huIgG4SP,…
Product Name : Anti-EphA2 Reference Antibody (Sanofi Aventis patent anti-EphA2)synonym : null,productDescription : Anti-EphA2 Reference Antibody (Sanofi Aventis patent anti-EphA2)(CHA044) is expressed from CHO. It has a predicted MW of…
Product Name : Anti-EphA2 Reference Antibody (MEDI-547)synonym : null,productDescription : Anti-EphA2 Reference Antibody (MEDI-547)(CHA043) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-ERBB1 / EGFR / HER1 Reference Antibody (cetuximab)synonym : null,productDescription : Anti-ERBB1 / EGFR / HER1 Reference Antibody (cetuximab)(CHA041) is expressed from CHO. The heavy chain type…
Product Name : Anti-TNFRSF10B / TRAILR2 / CD262 Reference Antibody (tigatuzumab)synonym : null,productDescription : Anti-TNFRSF10B / TRAILR2 / CD262 Reference Antibody (tigatuzumab)(CHA040) is expressed from CHO. The heavy chain type…
Product Name : Anti-TNFRSF10B / TRAILR2 / CD262 Reference Antibody (conatumumab)synonym : null,productDescription : Anti-TNFRSF10B / TRAILR2 / CD262 Reference Antibody (conatumumab)(CHA039) is expressed from CHO. The heavy chain type…
Product Name : Anti-DLL3 Reference Antibody (Dragonfly patent anti-DLL3)synonym : null,productDescription : Anti-DLL3 Reference Antibody (Dragonfly patent anti-DLL3)(CHA038) is expressed from CHO. It has a predicted MW of 144.16 kDa.molecularWeight…
Product Name : Anti-DLL3 Reference Antibody (rovalpituzumab)synonym : null,productDescription : Anti-DLL3 Reference Antibody (rovalpituzumab)(CHA037) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-LY75 / CD205/DEC-205 Reference Antibody (CDX-1401)synonym : null,productDescription : Anti-LY75 / CD205 Reference Antibody (CDX-1401)(CHA036) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-LY75 / CD205/DEC-205 Reference Antibody (MEN1309)synonym : null,productDescription : Anti-LY75 / CD205 Reference Antibody (MEN1309)(CHA035) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-CD4 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 51endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-CXCR4 / CD184 Reference Antibody (ulocuplumab)synonym : null,productDescription : Anti-CXCR4 / CD184 Reference Antibody (ulocuplumab)(CHA034) is expressed from CHO. The heavy chain type is huIgG4SP, and the…
Product Name : Anti-CX3CL1 / Fractalkine Reference Antibody (quetmolimab)synonym : null,productDescription : Anti-CX3CL1 / Fractalkine Reference Antibody (quetmolimab)(CHA033) is expressed from CHO. The heavy chain type is huIgG2, and the…
Product Name : Anti-CTLA-4 / CD152 Reference Antibody (ipilimumab)synonym : null,productDescription : Anti-CTLA-4 / CD152 Reference Antibody (ipilimumab)(CHA032) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-HGFR / c-Met Reference Antibody (onartuzumab)synonym : null,productDescription : Anti-HGFR / c-Met Reference Antibody (onartuzumab)(CHA030) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-CCN2 / CTGF Reference Antibody (pamrevlumab)synonym : null,productDescription : Anti-CCN2 / CTGF Reference Antibody (pamrevlumab)(CHA031) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-HGFR / c-Met Reference Antibody (telisotuzumab)synonym : null,productDescription : Anti-HGFR / c-Met Reference Antibody (telisotuzumab)(CHA029) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-TNFSF7 / CD27L / CD70 Reference Antibody (vorsetuzumab)synonym : null,productDescription : Anti-TNFSF7 / CD27L / CD70 Reference Antibody (vorsetuzumab)(CHA027) is expressed from CHO. The heavy chain type…
Product Name : Anti-HGFR / c-Met Reference Antibody (amivantamab)synonym : null,productDescription : Anti-HGFR / c-Met Reference Antibody (amivantamab)(CHA028) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-CD5 Reference Antibody (Magenta patent anti-CD5)synonym : null,productDescription : Anti-CD5 Reference Antibody (Magenta patent anti-CD5)(CHA025) is expressed from CHO. It has a predicted MW of 145.5 kDa.molecularWeight…
Product Name : Anti-CD7 Reference Antibody (Persongen patent anti-CD7)synonym : null,productDescription : Anti-CD7 Reference Antibody (Persongen patent anti-CD7)(CHA026) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-CD2 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 39endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-CD38 Reference Antibody (daratumumab)synonym : null,productDescription : Anti-CD38 Reference Antibody (daratumumab)(CHA024) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-TSPAN26 / CD37 Reference Antibody (naratuximab)synonym : null,productDescription : Anti-TSPAN26 / CD37 Reference Antibody (naratuximab)(CHA023) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-Siglec-3 / CD33 Reference Antibody (vadastuximab)synonym : null,productDescription : Anti-Siglec-3 / CD33 Reference Antibody (vadastuximab)(CHA022) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-TNFRSF7 / CD27 Reference Antibody (varlilumab)synonym : null,productDescription : Anti-TNFRSF7 / CD27 Reference Antibody (varlilumab)(CHA019) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-TNFRSF8 / CD30 Reference Antibody (brentuximab)synonym : null,productDescription : Anti-TNFRSF8 / CD30 Reference Antibody (brentuximab)(CHA021) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-IGF1R / CD221 Reference Antibody (cixutumumab)synonym : null,productDescription : Anti-IGF1R / CD221 Reference Antibody (cixutumumab)(CHA017) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-Siglec-2 / CD22 Reference Antibody (inotuzumab)synonym : null,productDescription : Anti-Siglec-2 / CD22 Reference Antibody (inotuzumab)(CHA018) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-CD20 / MS4A1 Reference Antibody (rituximab)synonym : null,productDescription : Anti-CD20 Reference Antibody (rituximab)(CHA015) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-CD20 / MS4A1 Reference Antibody (obinutuzumab)synonym : null,productDescription : Anti-CD20 Reference Antibody (obinutuzumab)(CHA016) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-CD19 Reference Antibody (tafasitamab)synonym : null,productDescription : Anti-CD19 Reference Antibody (tafasitamab)(CHA014) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-CD1a Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 37endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-CD19 Reference Antibody (inebilizumab)synonym : null,productDescription : Anti-CD19 Reference Antibody (inebilizumab)(CHA013) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-Spike S1 Reference Antibody (CR3022)synonym : null,productDescription : Anti-Spike S1 Reference Antibody (CR3022)(CHA005) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-MERS Reference Antibody (3A1)synonym : null,productDescription : Anti-MERS Reference Antibody (3A1)(CHA003) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-MERS Reference Antibody (D12)synonym : null,productDescription : Anti-MERS Reference Antibody (D12)(CHA004) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-SARS Reference Antibody (80R )synonym : null,productDescription : Anti-SARS Reference Antibody (80R )(CHA001) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-MERS Reference Antibody (2E6)synonym : null,productDescription : Anti-MERS Reference Antibody (2E6)(CHA002) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-H3L Antibody (NAL_A185)synonym : null,productDescription : Anti-H3L Antibody (AVA004) is expressed from CHO. The antibody type is VHH-Fc(huIgG1). It has a predicted MW of 146.12 kDa.molecularWeight :…
Product Name : Anti-E8L Antibody (NL_A151)synonym : null,productDescription : Anti-E8L Antibody (AVA003) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is hukappa. It…
Product Name : Anti-Spike RBD (Omicron BA.2 / BA.2.75) Antibody (dAb-708)synonym : productDescription : Anti-Spike RBD (Omicron BA.2 / BA.2.75) Antibody (dAb-708)(AVA002) is expressed from CHO. This antibody is a…
Product Name : Anti-Spike S1 (Omicron BA.2 / BA.2.75 / BA.4 / BA.5) Antibody (THS-699)synonym : productDescription : Anti-Spike S1 (Omicron BA.2 / BA.2.75 / BA.4 / BA.5) Antibody (THS-699)(AVA001)…
Product Name : Anti-Calretinin Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 32endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-Spike S1 Antibody (NCOV-S1P14-Fc)synonym : null,productDescription : Anti-Spike S1 Antibody (NCOV-S1P14-Fc)(ANA005) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-CD3d Rabbit mAbsynonym : productDescription : NonemolecularWeight : 19 kDaendotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : Humanconcentration : Ready-to-useAntibodies…
Product Name : Anti-Spike RBD Antibody (RP1-E4)synonym : null,productDescription : Anti-Spike RBD Antibody (RP1-E4)(ANA004) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-Spike RBD Antibody (RP1-H5)synonym : null,productDescription : Anti-Spike RBD Antibody (RP1-H5)(ANA003) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-Spike RBD Antibody (RP6-E2)synonym : null,productDescription : Anti-Spike RBD Antibody (RP6-E2)(ANA002) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-CTLA-8 / IL-17a Antibody (SY18-VHH-11)synonym : null,productDescription : Anti-CTLA-8 / IL-17a Antibody (SY18-VHH-11)(AHA027) is expressed from CHO. The antibody type is VHH-Fc（huIgG1）. It has a predicted MW…
Product Name : Anti-Spike RBD Antibody (RP6-E3)synonym : null,productDescription : Anti-Spike RBD Antibody (RP6-E3)(ANA001) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-Spike RBD (Omicron) Antibody (P26130)synonym : null,productDescription : Anti-Spike RBD (Omicron) Antibody (P26130)(AHA023) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-Spike RBD Antibody (R15-F7)synonym : null,productDescription : Anti-Spike RBD Antibody (R15-F7)(AHA020) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-Nucleocapsid Antibody (N-P10)synonym : null,productDescription : Anti-Nucleocapsid Antibody (N-P10)(AHA017) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is hukappa. It…
Product Name : Anti-Nucleocapsid Antibody (N-P11)synonym : null,productDescription : Anti-Nucleocapsid Antibody (N-P11)(AHA018) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is hukappa. It…
Product Name : Anti-Calponin Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 33endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-Spike RBD Antibody (R14-F8)synonym : null,productDescription : Anti-Spike RBD Antibody (R14-F8)(AHA013) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-Spike RBD Antibody (R16-F10)synonym : null,productDescription : Anti-Spike RBD Antibody (R16-F10)(AHA014) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-Nucleocapsid Antibody (N-18)synonym : null,productDescription : Anti-Nucleocapsid Antibody (N-18)(AHA009) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is hukappa. It…
Product Name : Anti-ACE2 Antibody (NCOV-7)synonym : null,productDescription : Anti-ACE2 Antibody (NCOV-7)(AHA007) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is hukappa. It…
Product Name : Anti-Nucleocapsid Antibody (N-9)synonym : null,productDescription : Anti-Nucleocapsid Antibody (N-9)(AHA006) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is hukappa. It…
Product Name : Anti-Spike RBD Antibody (P17-A11)synonym : null,productDescription : Anti-Spike RBD Antibody (P17-A11)(AHA004) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-Spike RBD Antibody (P20-B4)synonym : null,productDescription : Anti-Spike RBD Antibody (P20-B4)(AHA003) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-Spike RBD Antibody (P16-A3)synonym : null,productDescription : Anti-Spike RBD Antibody (P16-A3)(AHA001) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-NSE Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 47endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-Caldesmon Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 93endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-HIF-1α Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 93endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-Gastrin Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 11endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-IL-3Ra / CD123 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 43endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration :…
Product Name : Anti-CD99 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 19endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-WT1 Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 49endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-ZAP-70 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 70endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-VIP Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 19endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-Villin Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 93endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-Vimentin Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 54endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-VHL Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 24endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-Calcitonin Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 15endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-VEGFR2 / KDR / CD309Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 152endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration…
Product Name : Anti-β-tubulin-III Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 50endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-Tyrosinase Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 60endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-TTF-1 Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 39endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-Tryptase Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 31endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-TPO Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 103endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-TIA-1 Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 43endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-TOP2A Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 174endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-Thyroid Stimulating Hormone Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 16endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration :…
Product Name : Anti-TS Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 36endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-CA9 / CAIXMouse mAbsynonym : null,productDescription : NonemolecularWeight : 50endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies…
Product Name : Anti-TROP2Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 36endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are immunoglobulins…
Product Name : Anti-Synaptophysin Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 34endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-STAT6 Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 94endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-SOX10 Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 50endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-Somatostatin Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 13endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-SMA Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 42endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-SMARCA4 / Brg1 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 185endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration :…
Product Name : Anti-SDHA Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 73endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-S100P Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 10endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-FOLH1 / PSMA Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 84endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration :…
Product Name : Anti-C4d Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 193endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-PSAP Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 58endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-PSA Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 29endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-Protein Gene Product 9.5 Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 25endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration…
Product Name : Anti-Podoplanin Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 17endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-PMS2 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 96endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-PLAP Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 58endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-Pax8 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 48endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-PCNA Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 29endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-Pax-5 Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 42endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-p120 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 91endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-BOB.1 Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 27endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-p63 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 77endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-p57 Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 32endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-p27 Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 22endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-NSE Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 47endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-p16 Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 17endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-NGFR Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 45endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-nm23 Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 17endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-Neurofilament Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 102endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-NeuN Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 34endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-Napsin A Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 45endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies…
Product Name : Anti-Nestin Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 177endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-Bcl-6 Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 79endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-Myoglobin Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 17endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-MyoD1 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 35endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-Myelin Basic Protein Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 33endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration :…
Product Name : Anti-Myeloperoxidase Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 84endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-RSV-F Reference Antibody (palivizumab)synonym : null,productDescription : Anti-RSV-F Reference Antibody (palivizumab)(CVA006) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-MUM1 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 79endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-RSV-F Reference Antibody (motavizumab)synonym : null,productDescription : Anti-RSV-F Reference Antibody (motavizumab)(CVA005) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-Rabies virus GP Reference Antibody (foravirumab)synonym : null,productDescription : Anti-Rabies virus GP Reference Antibody (foravirumab)(CVA003) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-Rabies virus GP Reference Antibody (rafivirumab)synonym : null,productDescription : Anti-Rabies virus GP Reference Antibody (rafivirumab)(CVA004) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-HBsAg Reference Antibody (OST 577)synonym : null,productDescription : Anti-HBsAg Reference Antibody (OST 577)(CVA002) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-CLDN6 Reference Antibody (IM-302)synonym : null,productDescription : Anti-CLDN6 Reference Antibody (IM-302) (COA006) is expressed from CHO. The heavy chain type is IgG10, and the light chain type…
Product Name : Anti-CLDN6 Reference Antibody (IM-301)synonym : null,productDescription : Anti-CLDN6 Reference Antibody (IM-301) (COA005) is expressed from CHO. The heavy chain type is IgG1, and the light chain type…
Product Name : Anti-MUC6 Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 257endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-Shiga toxin (E.coli) Reference Antibody (pritoxaximab)synonym : null,productDescription : Anti-Shiga toxin (E.coli) Reference Antibody (pritoxaximab)(COA003) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-Shiga toxin (E.coli) Reference Antibody (setoxaximab)synonym : null,productDescription : Anti-Shiga toxin (E.coli) Reference Antibody (setoxaximab)(COA004) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-Abm Reference Antibody ( IgG4+Kappa Isotype Control)synonym : null,productDescription : Anti-Abm Reference Antibody ( IgG4+Kappa Isotype Control)(COA002) is expressed from CHO. The heavy chain type is huIgG4SP,…
Product Name : Anti-LIV-1 / SLC39A6 Mouse Antibodysynonym : null,productDescription : Anti-LIV-1 / SLC39A6 Mouse Antibody (CMA006) is expressed from CHO. The heavy chain type is mIgG2a, and the light…
Product Name : Anti-Abm Reference Antibody ( IgG1+Kappa Isotype Control)synonym : null,productDescription : Anti-Abm Reference Antibody ( IgG1+Kappa Isotype Control)(COA001) is expressed from CHO. The heavy chain type is huIgG1,…
Product Name : Anti-Tau Reference Antibody (A119)synonym : null,productDescription : NonemolecularWeight : 145.54 kDaendotoxin : ＜1.0 EU per ugpurity : >95% as determined by SDS-PAGE.formulation : Nonestorage : -80°C for…
Product Name : Anti-Tau Reference Antibody (A155)synonym : null,productDescription : NonemolecularWeight : 144.06 kDaendotoxin : ＜1.0 EU per ugpurity : >95% as determined by SDS-PAGE.formulation : Nonestorage : -80°C for…
Product Name : Anti-Tau Reference Antibody (A080)synonym : null,productDescription : NonemolecularWeight : 145.32 kDaendotoxin : ＜1.0 EU per ugpurity : >95% as determined by SDS-PAGE.formulation : Nonestorage : -80°C for…
Product Name : Anti-Tau Reference Antibody (A105)synonym : null,productDescription : NonemolecularWeight : 144.62 kDaendotoxin : ＜1.0 EU per ugpurity : >95% as determined by SDS-PAGE.formulation : Nonestorage : -80°C for…
Product Name : Anti-MUC5AC Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 586endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-Tau Reference Antibody (A103)synonym : null,productDescription : NonemolecularWeight : 143.94 kDaendotoxin : ＜1.0 EU per ugpurity : >95% as determined by SDS-PAGE.formulation : Nonestorage : -80°C for…
Product Name : Anti-Tau Reference Antibody (A054)synonym : null,productDescription : NonemolecularWeight : 145.12 kDaendotoxin : ＜1.0 EU per ugpurity : >95% as determined by SDS-PAGE.formulation : Nonestorage : -80°C for…
Product Name : Anti-Tau Reference Antibody (pT217,rabbit IgG1)synonym : null,productDescription : NonemolecularWeight : 139.52 kDaendotoxin : ＜1.0 EU per ugpurity : >95% as determined by SDS-PAGE.formulation : Nonestorage : -80°C…
Product Name : Anti-Tau Reference Antibody (pT217,mouse IgG1)synonym : null,productDescription : NonemolecularWeight : 141.94 kDaendotoxin : ＜1.0 EU per ugpurity : >95% as determined by SDS-PAGE.formulation : Nonestorage : -80°C…
Product Name : Anti-Tau Reference Antibody (pT217,human IgG1)synonym : null,productDescription : NonemolecularWeight : 142.34 kDaendotoxin : ＜1.0 EU per ugpurity : >95% as determined by SDS-PAGE.formulation : Nonestorage : -80°C…
Product Name : Anti-Tau Reference Antibody (posdinemab)synonym : null,productDescription : NonemolecularWeight : 145.52 kDaendotoxin : ＜1.0 EU per ugpurity : >95% as determined by SDS-PAGE.formulation : Nonestorage : -80°C for…
Product Name : Anti-Amyloid Beta Reference Antibody (Aβab002)synonym : null,productDescription : NonemolecularWeight : 147.06 kDaendotoxin : ＜1.0 EU per ugpurity : >95% as determined by SDS-PAGE.formulation : Nonestorage : -80°C…
Product Name : Anti-TL1A Reference Antibody (PF-06480605)synonym : productDescription : NonemolecularWeight : 146.54endotoxin : 95%formulation : 1 x PBS ,pH 6.0storage : -80°C for 2 years under sterile conditions； -20°C…
Product Name : Anti-Amyloid Beta Reference Antibody (Aβab001)synonym : null,productDescription : NonemolecularWeight : 145.36 kDaendotoxin : ＜1.0 EU per ugpurity : >95% as determined by SDS-PAGE.formulation : Nonestorage : -80°C…
Product Name : Anti-TL1A Reference Antibody (PR200，5C3D11)synonym : productDescription : NonemolecularWeight : 144.42endotoxin : 95%formulation : 1 x PBS ,pH 6.0storage : -80°C for 2 years under sterile conditions； -20°C…
Product Name : Anti-MMAEsynonym : productDescription : NonemolecularWeight : 146.32 KDaendotoxin : ＜1 EU/mgpurity : >95%formulation : 0.1M Na3C6H507·2H2O,0.2M NaCl,pH 5.0storage : -80°C for 2 years under sterile conditions； -20°C…
Product Name : Anti-MUC2 Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 540endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-BSG2 / CD147 Reference Antibody (HcHAb18-DM1）synonym : productDescription : NonemolecularWeight : 145.14 kDaendotoxin : ＜0.001 EU/ugpurity : ＞95% as determined by SEC-HPLC.formulation : 1 x PBS ,pH…
Product Name : Anti-CLDN18.2 Reference Antibody (zolbetuximab MMAE)synonym : productDescription : .Anti-CLDN18.2 Reference Antibody (zolbetuximab MMAE) is an ADC consisting of a CLDN18.2-directed antibody and MMAE.molecularWeight : 150 kDaendotoxin :…
Product Name : Anti-TL1A Reference Antibody (PR200，1D1)synonym : productDescription : NonemolecularWeight : 144.26 kDaendotoxin : 95%formulation : 100mMPro-Ac,20mMArg，pH5.0storage : -80°C for 2 years under sterile conditions； -20°C for 1 year…
Product Name : Anti-CD3 & EpCAM Reference Antibody (Catumaxomab(huIgG1-rat IgG2b))synonym : null,productDescription : Anti-CD3 & EpCAM Reference Antibody (Catumaxomab(huIgG1-rat IgG2b)) (CHB469) is expressed from CHO, with a configuration of TrioMab.…
Product Name : Anti-EGFR & Fc-gamma-RIIIA Reference Antibody (AFM24)synonym : null,productDescription : Anti-EGFR & Fc-gamma-RIIIA Reference Antibody (AFM24) (CHB480) is expressed from CHO, with a configuration of TandAb. The heavy…
Product Name : Anti-CD3 & FCRL5 Reference Antibody (Cevostamab)synonym : null,productDescription : Anti-CD3 & FCRL5 Reference Antibody (Cevostamab) (CHB467) is expressed from CHO, with a configuration of CrossMab. The heavy…
Product Name : Anti-CD3 & EpCAM Reference Antibody (Catumaxomab(mIgG2a-rat IgG2b))synonym : null,productDescription : Anti-CD3 & EpCAM Reference Antibody (Catumaxomab(mIgG2a-rat IgG2b)) (CHB468) is expressed from CHO, with a configuration of TrioMab.…
Product Name : Anti-CD3 & CD20 Reference Antibody (Epcoritamab)synonym : null,productDescription : Anti-CD3 & CD20 Reference Antibody (Epcoritamab) (CHB456) is expressed from CHO, with a configuration of DuoBody. The heavy…
Product Name : Anti-BAFF & IL-17A Reference Antibody (Tibulizumab)synonym : null,productDescription : Anti-BAFF & IL-17A Reference Antibody (Tibulizumab) (CHB464) is expressed from CHO, with a configuration of IgG-scFv. The heavy…
Product Name : Anti-CD3 & BCMA Reference Antibody (Teclistamab)synonym : null,productDescription : Anti-CD3 & BCMA Reference Antibody (Teclistamab) (CHB454) is expressed from CHO, with a configuration of DuoBody. The heavy…
Product Name : Anti-MSH6 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 153endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-CD123 & CD3 Reference Antibody (Flotetuzumab)synonym : null,productDescription : Anti-CD123 & CD3 Reference Antibody (Flotetuzumab) (CHB444) is expressed from CHO, with a configuration of DART. The heavy…
Product Name : Anti-IL-1a & IL1b Reference Antibody (Lutikizumab)synonym : null,productDescription : Anti-IL1a & IL1b Reference Antibody (Lutikizumab) (CHB431) is expressed from CHO, with a configuration of DVD-Ig. The heavy…
Product Name : Anti-GPRC5D & CD3 Reference Antibody (Talquetamab)synonym : null,productDescription : Anti-GPRC5D & CD3 Reference Antibody (Talquetamab) (CHB443) is expressed from CHO, with a configuration of DuoBody. The heavy…
Product Name : Anti-TNFalpha & IL-17 Reference Antibody (ABT122)synonym : null,productDescription : Anti-TNFalpha & IL17 Reference Antibody (ABT122) (CHB430) is expressed from CHO, with a configuration of DVD-Ig. The heavy…
Product Name : Anti-ANG2 & VEGFA Reference Antibody (Vanucizumab)synonym : null,productDescription : Anti-ANG2 & VEGFA Reference Antibody (Vanucizumab)(CHB427) is expressed from CHO, with a configuration of CrossMab. The heavy chain…
Product Name : Anti-ANG2 & VEGFA Reference Antibody (Faricimab)synonym : null,productDescription : Anti-ANG2 & VEGFA Reference Antibody (Faricimab) (CHB426) is expressed from CHO, with a configuration of CrossMab. The heavy…
Product Name : Anti-LGR5 & EGFR Reference Antibody (Petosemtamab)synonym : null,productDescription : Anti-LGR5 & EGFR Reference Antibody (Petosemtamab) (CHB414) is expressed from CHO, with a configuration of Biclonics. The heavy…
Product Name : Anti-CD137 & Her2 Reference Antibody (Cinrebafusp alfa)synonym : null,productDescription : Anti-CD137 & Her2 Reference Antibody (Cinrebafusp alfa) (CHB419) is expressed from CHO, with a configuration of Anticalin.…
Product Name : Anti-CanAg Reference Antibody (Cantuzumab)synonym : null,productDescription : Anti-CanAg Reference Antibody (Cantuzumab)(CHB363) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-MSH2 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 105endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-ADAM9 Reference Antibody (Imgc936)synonym : null,productDescription : Anti-ADAM9 Reference Antibody (Imgc936)(CHA362) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-EpCAM / TROP1 / CD326 Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 122 kDaendotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity…
Product Name : Anti-GPC2 / Glypican 2 Reference Antibody (Nih Patent Anti-Glypican-2)synonym : null,productDescription : Anti-GPC2 / Glypican 2 Reference Antibody (Nih Patent Anti-Glypican-2)(CHB361) is expressed from CHO. The heavy…
Product Name : Anti-MAGE-A4 Reference Antibody (Imc-C103C)synonym : null,productDescription : Anti-MAGE-A4 Reference Antibody (Imc-C103C)(CHB360) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-NAMPT Reference Antibody (Alt-100)synonym : null,productDescription : Anti-NAMPT Reference Antibody (Alt-100)(CHB359) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-SEZ6 Reference Antibody (Abbv-011)synonym : null,productDescription : Anti-SEZ6 Reference Antibody (Abbv-011)(CHB357) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-CD93 Reference Antibody (Dcby02)synonym : null,productDescription : Anti-CD93 Reference Antibody (Dcby02)(CHB358) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-SLC7A11 Reference Antibody (Agilvax Patent Anti-Slc7A11)synonym : null,productDescription : Anti-SLC7A11 Reference Antibody (Agilvax Patent Anti-Slc7A11)(CHB354) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-ALP Reference Antibody (Seagen Patent Anti-Alpp)synonym : null,productDescription : Anti-ALP Reference Antibody (Seagen Patent Anti-Alpp)(CHB355) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-TREM2 Reference Antibody (PY314)synonym : null,productDescription : Anti-TREM2 Reference Antibody (Py314)(CHB356) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-MLH1 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 85endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-Meflin Reference Antibody (Tokai U. Patent Anti-Meflin)synonym : null,productDescription : Anti-Meflin Reference Antibody (Tokai U. Patent Anti-Meflin)(CHB353) is expressed from CHO. The heavy chain type is huIgG1,…
Product Name : Anti-CD98 Reference Antibody (Ign523)synonym : null,productDescription : Anti-CD98 Reference Antibody (Ign523)(CHB351) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-CD36 Reference Antibody (Ona Thera Patent Anti-Cd36)synonym : null,productDescription : Anti-CD36 Reference Antibody (Ona Thera Patent Anti-Cd36)(CHB352) is expressed from CHO. The heavy chain type is huIgG1,…
Product Name : Anti-PVR / CD155 Reference Antibody (Ntx1088)synonym : null,productDescription : Anti-PVR / CD155 Reference Antibody (Ntx1088)(CHB350) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-Transferrin receptor / CD71 Reference Antibody (Jr-141)synonym : null,productDescription : Anti-Transferrin receptor / CD71 Reference Antibody (Jr-141)(CHB347) is expressed from CHO. The heavy chain type is huIgG1,…
Product Name : Anti-MSPR / RON / CD136 Reference Antibody (H5B14)synonym : null,productDescription : Anti-MSPR / RON / CD136 Reference Antibody (H5B14)(CHB348) is expressed from CHO. The heavy chain type…
Product Name : Anti-CDCP1 / CD318 Reference Antibody (38 E11)synonym : null,productDescription : Anti-CDCP1 / CD318 Reference Antibody (38 E11)(CHB349) is expressed from CHO. The heavy chain type is huIgG1,…
Product Name : Anti-MRC2 / CD280 Reference Antibody (Quark Patent Anti-Endo180)synonym : null,productDescription : Anti-MRC2 / CD280 Reference Antibody (Quark Patent Anti-Endo180)(CHB345) is expressed from CHO. The heavy chain type…
Product Name : Anti-Fc gamma R1 Reference Antibody (Medarex Patent Anti-Fc-Gamma-R1)synonym : null,productDescription : Anti-Fc gamma R1 Reference Antibody (Medarex Patent Anti-Fc-Gamma-R1)(CHB346) is expressed from CHO. The heavy chain type…
Product Name : Anti-MART-1/melan A Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 13endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies…
Product Name : Anti-TM4SF1 Reference Antibody (Beth Israel Patent Anti-TM4SF1)synonym : null,productDescription : Anti-TM4SF1 Reference Antibody (Beth Israel Patent Anti-TM4SF1)(CHB343) is expressed from CHO. The heavy chain type is huIgG1,…
Product Name : Anti-ENPP3 / CD203c Reference Antibody (Ags-16C3F)synonym : null,productDescription : Anti-ENPP3 / CD203c Reference Antibody (Ags-16C3F)(CHB344) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-ROR2 Reference Antibody (Ozuriftamab)synonym : null,productDescription : Anti-ROR2 Reference Antibody (Ozuriftamab)(CHB342) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-Siglec-3 / CD33 Reference Antibody (Gemtuzumab)synonym : null,productDescription : Anti-Siglec-3 / CD33 Reference Antibody (Gemtuzumab)(CHB341) is expressed from CHO. The heavy chain type is huIgG4SP, and the…
Product Name : Anti-ERBB1 / EGFR / HER1 Reference Antibody (Serclutamab talirine)synonym : productDescription : ABBV-321 (serclutamab talirine), a next-generation epidermal growth factor receptor (EGFR)-targeted antibody-drug conjugate (ADC) incorporates a…
Product Name : Anti-TROP2 Reference Antibody (Datopotamab)synonym : null,productDescription : Anti-TROP2 Reference Antibody (Datopotamab)(CHB340) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-SLITRK6 Reference Antibody (Sirtratumab vedotin)synonym : null,productDescription : Sirtratumab vedotin is an ADC consisting of a SLITRK6-directed antibody and Monomethyl auristatin E (MMAE) used for the study…
Product Name : Anti-MUC16 Reference Antibody (Sofituzumab vedotin)synonym : productDescription : Sofituzumab vedotin is an antibody-drug conjugate that targets MUC16, The conjugate consists of a human anti-MUC16 antibody linked to…
Product Name : Anti-ERBB1 / EGFR / HER1 Reference Antibody (Laprituximab emtansine)synonym : null,productDescription : Laprituximab emtansine is an ADC consisting of an EGFR-directed antibody and DM1, a potent derivative…
Product Name : Anti-CD79b Reference Antibody (iladatuzumab vedotin)synonym : productDescription : iladatuzumab vedotin is an ADC consisting of a CD79b-directed antibody and Monomethyl auristatin E (MMAE) used for the study…
Product Name : Anti-TNFSF7 / CD27L / CD70 Reference Antibody (Vorsetuzumab mafodotin)synonym : productDescription : Vorsetuzumab mafodotin is a humanized anti-CD70 monoclonal antibody attached to a potent, synthetic drug payload,…
Product Name : Anti-Mammaglobin Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 10endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-CanAg Reference Antibody (Cantuzumab ravtansine)synonym : null,productDescription : Cantuzumab ravtansine is an ADC consisting of a CanAg-directed antibody and DM4 that has extensive antitumor efficacy in a…
Product Name : Anti-CanAg Reference Antibody (Cantuzumab mertansine)synonym : null,productDescription : Cantuzumab mertansine is an ADC consisting of a CanAg-directed antibody and DM1, a potent derivative of maytansine, used for…
Product Name : Anti-CD19 Reference Antibody (Loncastuximab tesirine)synonym : null,productDescription : Loncastuximab tesirine is an ADC consisting of a CD19-directed antibody and Tesirine that induces cell apoptosis and is used…
Product Name : Anti-Siglec-3 / CD33 Reference Antibody (Gemtuzumab ozogamicin)synonym : null,productDescription : Gemtuzumab ozogamicin is an ADC consisting of a CD33-directed antibody and a cytotoxic derivative of calicheamicin used…
Product Name : Anti-Siglec-2 / CD22 Reference Antibody (inotuzumab-MMAE)synonym : null,productDescription : Anti-Siglec-2 / CD22 Reference Antibody (inotuzumab-MMAE)(CHB301) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-ERBB2 / HER2 / CD340 Reference Antibody (Trastuzumab duocarmazine)synonym : null,productDescription : Trastuzumab duocarmazine is an ADC consisting of a HER2-directed antibody and duocarmycin used for the…
Product Name : Anti-ERBB3/ HER3 Reference Antibody (Patritumab deruxtecan)synonym : productDescription : Anti-ERBB3/ HER3 Reference Antibody (Patritumab deruxtecan) is a novel ADC composed of an anti-HER3 antibody (Patritumab) and a…
Product Name : Anti-ERBB1 / EGFR / HER1 Reference Antibody (Cetuximab-MMAE)synonym : productDescription : Cetuximab-MMAE is an ADC consisting of an EGFR-directed antibody and Monomethyl auristatin E (MMAE) used for…
Product Name : Anti-Siglec-3 / CD33 Reference Antibody (vadastuximab talirine)synonym : null,productDescription : Vadastuximab talirine is an ADC consisting of a CD33-directed antibody and PBD used for the study of…
Product Name : Anti-TROP2 Reference Antibody (Sacituzumab-MMAE)synonym : null,productDescription : Anti-TROP2 Reference Antibody (Sacituzumab-MMAE)(CHB295) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-FOLR1 / FRA Reference Antibody (mirvetuximab-MMAE)synonym : null,productDescription : Anti-FOLR1 Reference Antibody (mirvetuximab-MMAE)(CHB296) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-LEF-1 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 44endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-CA9 / CAIX Reference Antibody (girentuximab-MMAE)synonym : null,productDescription : Anti-CAIX Reference Antibody (girentuximab-MMAE)(CHB293) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-DLL3 Reference Antibody (rovalpituzumab-MMAE)synonym : null,productDescription : Anti-DLL3 Reference Antibody (rovalpituzumab-MMAE)(CHB294) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-MUC1 Reference Antibody (clivatuzumab-MMAE)synonym : productDescription : Clivatuzumab-MMAE is an ADC consisting of a MUC1-directed antibody and Monomethyl auristatin E (MMAE) used for the study of pancreatic…
Product Name : Anti-IL-3Ra / CD123 Reference Antibody (talacotuzumab-MMAE)synonym : null,productDescription : Talacotuzumab-MMAE is an ADC consisting of an IL-3Rα-directed antibody and Monomethyl auristatin E (MMAE) used for the study…
Product Name : Anti-Endoglin / CD105 Reference Antibody (carotuximab-MMAE)synonym : null,productDescription : Carotuximab-MMAE is an ADC consisting of a CD105-directed antibody and Monomethyl auristatin E (MMAE) that exhibits antitumor activity.molecularWeight…
Product Name : Anti-MU5AC Reference Antibody (ensituximab-MMAE)synonym : null,productDescription : Anti-MU5AC Reference Antibody (ensituximab-MMAE)(CHB288) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-AMHR2 Reference Antibody (Murlentamab-MMAE)synonym : productDescription : Murlentamab-MMAE is an ADC consisting of an AMHR2-directed antibody and Monomethyl auristatin E (MMAE) used for the study of colorectal…
Product Name : Anti-CXCR4/CD184 Reference Antibody (ulocuplumab-MMAE)synonym : null,productDescription : Anti-CXCR4/CD184 Reference Antibody (ulocuplumab-MMAE)(CHB286) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-GD3 Reference Antibody (ecromeximab-MMAE)synonym : null,productDescription : Anti-GD3 Reference Antibody (ecromeximab-MMAE)(CHB287) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-Langerin Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 37endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-FOLR1 / FRA Reference Antibody (farletuzumab-MMAE)synonym : null,productDescription : Farletuzumab-MMAE is an ADC consisting of an FRA-directed antibody and Monomethyl auristatin E (MMAE) used for the study…
Product Name : Anti-FOLH1 / PSMA Reference Antibody (rosopatamab tetraxetan)synonym : null,productDescription : Rosopatamab tetraxetan is an ADC consisting of a PSMA-directed antibody and DM1, a potent derivative of maytansine,…
Product Name : Anti-FOLH1 / PSMA Reference Antibody (rosopatamab-MMAE)synonym : null,productDescription : Rosopatamab-MMAE is an ADC consisting of a PSMA-directed antibody and Monomethyl auristatin E (MMAE) used for the study…
Product Name : Anti-ERBB2 / HER2 / CD340 Reference Antibody (Trastuzumab-MMAE)synonym : null,productDescription : Trastuzumab MMAE is an ADC consisting of a HER2-directed antibody and Monomethyl auristatin E (MMAE) used…
Product Name : Anti-NCAM1 / CD56 Reference Antibody (lorvotuzumab mertansine)synonym : null,productDescription : Lorvotuzumab mertansine is an ADC consisting of an NCAM-directed antibody and DM1, a potent derivative of maytansine,…
Product Name : Anti-NCAM1 / CD56 Reference Antibody (lorvotuzumab-MMAE)synonym : null,productDescription : Lorvotuzumab-MMAE is an ADC consisting of an NCAM-directed antibody and Monomethyl auristatin E (MMAE) used for the study…
Product Name : Anti-Mesothelin Reference Antibody (anetumab-MMAE)synonym : productDescription : Anetumab-MMAE is an ADC consisting of a Mesothelin-directed antibody and Monomethyl auristatin E (MMAE) used for the study of advanced…
Product Name : Anti-ERBB2 / HER2 / CD340 Reference Antibody (Trastuzumab emtansine)synonym : null,productDescription : Trastuzumab emtansine is an ADC consisting of a HER2-directed antibody and DM1, a potent derivative…
Product Name : Anti-Mesothelin Reference Antibody (anetumab ravtansine)synonym : null,productDescription : Anetumab ravtansine is an ADC consisting of a Mesothelin-directed antibody and DM4 used for the study of several solid…
Product Name : Anti-CEACAM5 / CEA / CD66e Reference Antibody (Tusamitamab-MMAE)synonym : productDescription : Tusamitamab-MMAE is an ADC consisting of a CEACAM5-directed antibody and Monomethyl auristatin E (MMAE) used for…
Product Name : Anti-Lambda Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 11endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-CEACAM5 / CEA / CD66e Reference Antibody (Tusamitamab ravtansine)synonym : productDescription : Tusamitamab ravtansine is a novel antibody-drug conjugate that selectively targets CEACAM5, a cell surface glycoprotein…
Product Name : Anti-FOLR1 / FRA Reference Antibody (Mirvetuximab soravtansine)synonym : productDescription : Mirvetuximab soravtansine is an ADC consisting of an FRA-directed antibody and DM4 used for the study of…
Product Name : Anti-ALCAM/CD166 Reference Antibody (praluzatamab ravtansine)synonym : null,productDescription : Praluzatamab ravtansine is an ADC consisting of an ALCAM-directed antibody and DM4 used for the study of breast cancer.molecularWeight…
Product Name : Anti-ALCAM / CD166 Reference Antibody (Praluzatamab-MMAE)synonym : productDescription : Praluzatamab-MMAE is an ADC consisting of an ALCAM-directed antibody and Monomethyl auristatin E (MMAE) used for the study…
Product Name : Anti-MUC16 Reference Antibody (oregovomab-MMAE)synonym : null,productDescription : Anti-MUC16 Reference Antibody (oregovomab-MMAE)(CHB269) is expressed from CHO. The heavy chain type is huIgG2, and the light chain type is…
Product Name : Anti-TROP2 Reference Antibody (datopotamab deruxtecan)synonym : null,productDescription : Datopotamab deruxtecan is an ADC consisting of a TROP2-directed antibody and Dxd, a topoisomerase I inhibitor, used for the…
Product Name : Anti-ERBB1 / EGFR / HER1 Reference Antibody (depatuxizumab-MMAF)synonym : productDescription : Depatuxizumab-MMAF is an ADC consisting of an EGFR-directed antibody and McMMAF used for the study of…
Product Name : Anti-ERBB3/ HER3 Reference Antibody (patritumab-MMAE)synonym : null,productDescription : Anti-ERBB3/HER3 Reference Antibody (patritumab-MMAE)(CHB268) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type…
Product Name : Anti-ROR1 Reference Antibody (Zilovertamab vedotin)synonym : productDescription : zilovertamab vedotin is an investigational antibody-drug conjugate (ADC) comprising a ROR1-targeting monoclonal antibody that is linked to a cytotoxin…
Product Name : Anti-ROR2 Reference Antibody (ozuriftamab vedotin)synonym : productDescription : Ozuriftamab vedotin is an antibody-drug conjugate (ADC) composed of ozuriftamab, a conditionally active biologic (CAB) antibody against receptor tyrosine…
Product Name : Anti-Siglec-2 / CD22 Reference Antibody (Pinatuzumab vedotin)synonym : productDescription : Pinatuzumab vedotin is an ADC consisting of a CD22-directed antibody and Monomethyl auristatin E (MMAE) used for…
Product Name : Anti-CEACAM5 / CEA / CD66e Reference Antibody (labetuzumab govitecan)synonym : productDescription : Labetuzumab Govitecan is an antibody-drug conjugate (ADC) containing labetuzumab, a mildly reduced, anti-CEACAM5 humanized monoclonal…
Product Name : Anti-NaPi2b / SLC34A2 Reference Antibody (Lifastuzumab vedotin)synonym : productDescription : Lifastuzumab vedotin is an ADC consisting of an anti-NaPi2b monoclonal antibody conjugated to the cytotoxic agent MMAEmolecularWeight…
Product Name : Anti-Ksp Cadherin Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 90endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies…
Product Name : Anti-GPNMB Reference Antibody (Glembatumumab vedotin)synonym : productDescription : Glembatumumab vedotin targets GPNMB, a protein located specifically on the surface of melanoma cells. After Glembatumumab vedotin binds to…
Product Name : Anti-GUCY2C Reference Antibody (Indusatumab vedotin)synonym : productDescription : Indusatumab vedotin is an antibody-drug conjugate that is under development for the treatment of pancreatic cancer and other gastrointestinal…
Product Name : Anti-AXL / UFO Reference Antibody (Enapotamab vedotin)synonym : productDescription : Enapotamab vedotin (previously referred to as HuMax-AXL-ADC or AXL-107-MMAE) is a clinical-stage AXL-specific antibody-drug conjugate that was…
Product Name : Anti-CD19 Reference Antibody (denintuzumab-MMAF)synonym : null,productDescription : Denintuzumab-MMAF is an ADC consisting of a CD19-directed antibody and McMMAF used for the study of acute lymphoblastic leukemia.molecularWeight :…
Product Name : Anti-TF / Factor III / Tissue Factor / CD142 Reference Antibody (tisotumab vedotin)synonym : productDescription : Tisotumab vedotin is an ADC consisting of a Tissue Factor-directed antibody…
Product Name : Anti-Siglec-2 / CD22 Reference Antibody (inotuzumab-CLM)synonym : null,productDescription : Anti-Siglec-2 / CD22 Reference Antibody (inotuzumab-CLM)(CHB255) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-CD79b Reference Antibody (Polatuzumab vedotin-piiq)synonym : productDescription : Polatuzumab vedotin (Polivy) is an ADC consisting of a CD79b-directed antibody and Monomethyl auristatin E (MMAE) that can be…
Product Name : Anti-Siglec-3 / CD33 Reference Antibody (gemtuzumab-CLM)synonym : null,productDescription : Anti-Siglec-3 / CD33 Reference Antibody (gemtuzumab-CLM)(CHB254) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-ERBB2 / HER2 / CD340 Reference Antibody (Disitamab vedotin)synonym : productDescription : Disitamab vedotin is an ADC consisting of a HER2-directed antibody and Monomethyl auristatin E (MMAE).…
Product Name : Anti-Ki-67 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 359endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-TNFRSF17 / BCMA / CD269 Reference Antibody (belantamab mafodotin)synonym : null,productDescription : Belantamab mafodotin is an ADC consisting of a BCMA-directed antibody and McMMAF used for the…
Product Name : Anti-TNFRSF8 / CD30 Reference Antibody (brentuximab vedotin)synonym : productDescription : Brentuximab vedotin is an ADC consisting of a CD30-directed antibody and Monomethyl auristatin E (MMAE) that inhibits…
Product Name : Anti-HGFR / c-Met Reference Antibody (Telisotuzumab vedotin)synonym : productDescription : Telisotuzumab vedotin is a first-in-class antibody-drug conjugate (ADC) comprised of the anti-c-Met antibody, ABT-700, and monomethyl auristatin…
Product Name : Anti-LIV-1 / SLC39A6 Reference Antibody (Ladiratuzumab vedotin)synonym : productDescription : Ladiratuzumab vedotin is an ADC that combines a humanized anti-LIV-1 monoclonal antibody linked to a synthetic cytotoxic…
Product Name : Anti-Nectin-4 Reference Antibody (enfortumab vedotin-ejfv)synonym : productDescription : Enfortumab vedotin-ejfv is an ADC consisting of a Nectin-4-directed antibody and Monomethyl auristatin E (MMAE) , suitable for adult…
Product Name : Anti-CLDN6 Reference Antibody (AB1-11)synonym : null,productDescription : Anti-CLDN6 Reference Antibody (AB1-11) (CHB235) is expressed from CHO. The heavy chain type is IgG1, and the light chain type…
Product Name : Anti-ERBB2 / HER2 / CD340 Reference Antibody (Trastuzumab deruxtecan)synonym : productDescription : Trastuzumab deruxtecan is a HER2-targeting ADC structurally composed of a humanized anti-HER2 antibody, enzymatically cleavable…
Product Name : Anti-CLDN6 Reference Antibody (AB3-7)synonym : null,productDescription : Anti-CLDN6 Reference Antibody (AB3-7) (CHB235) is expressed from CHO. The heavy chain type is IgG1, and the light chain type…
Product Name : Anti-Kappa Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 12endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-CLDN6 Reference Antibody (64A)synonym : null,productDescription : Anti-CLDN6 Reference Antibody (64A) (CHB234) is expressed from CHO. The heavy chain type is IgG1 and the light chain type…
Product Name : Anti-CDH17 / Cadherin-17 Reference Antibody (PTA001_A4)synonym : null,productDescription : Anti-CDH17 / Cadherin-17 Reference Antibody (PTA001_A4) (CHB230) is expressed from CHO. The heavy chain type is IgG2, and…
Product Name : Anti-CLDN6 Reference Antibody (DS-9606a)synonym : null,productDescription : Anti-CLDN6 Reference Antibody (DS-9606a) (CHB232) is expressed from CHO. The heavy chain type is IgG1, and the light chain type…
Product Name : Anti-CLDN6 Reference Antibody (AE3-20)synonym : null,productDescription : Anti-CLDN6 Reference Antibody (AE3-20) (CHB233) is expressed from CHO. The heavy chain type is IgG1, and the light chain type…
Product Name : Anti-CDH17 / Cadherin-17 Reference Antibody (10C12)synonym : null,productDescription : Anti-CDH17 / Cadherin-17 Reference Antibody (10C12) (CHB229) is expressed from CHO. The heavy chain type is IgG1, and…
Product Name : Anti-AXL / UFO Reference Antibody (Tilvestamab-MMAE)synonym : null,productDescription : Tilvestamab-MMAE is an ADC consisting of an AXL-directed antibody and Monomethyl auristatin E (MMAE) used for the study…
Product Name : Anti-SIRPa / CD172a Reference Antibody (BI 765063)synonym : null,productDescription : Anti-SIRPa / CD172a Reference Antibody (BI 765063) (CHB228) is expressed from CHO. The heavy chain type is…
Product Name : Anti-TROP2 Reference Antibody (Sacituzumab govitecan)synonym : productDescription : Sacituzumab govitecan is an ADC that contains SN-38, the active metabolite of irinotecan, approved by many Health Authorities. SN-38…
Product Name : Anti-KAAG1 Reference Antibody (ADCT-901-MMAE)synonym : null,productDescription : Anti-KAAG1 Reference Antibody (ADCT-901-MMAE)(CHB238) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-Insulin Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 12endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-BTN1A1 Reference Antibody (ICT-01-N297A)synonym : null,productDescription : Anti-BTN1A1 Reference Antibody (ICT-01-N297A)(CHB222) is expressed from CHO. The heavy chain type is IgG1, and the light chain type is…
Product Name : Anti-GPC3 / Glypican-3 Reference Antibody (Codrituzumab-MMAE)synonym : productDescription : Codrituzumab-MMAE is an ADC consisting of a GPC3-directed antibody and Monomethyl auristatin E (MMAE) used for the study…
Product Name : Anti-Bax Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 21 kDaendotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : Humanconcentration : Ready-to-useAntibodies…
Product Name : Anti-AA2AR / Adenosine A2aR Reference Antibody (3F6-9G5)synonym : null,productDescription : Anti-AA2AR / Adenosine A2aR Reference Antibody (3F6-9G5)(CHB220) is expressed from CHO. The heavy chain type is IgG1,…
Product Name : Anti-BTN1A1 Reference Antibody (ICT-01)synonym : null,productDescription : Anti-BTN1A1 Reference Antibody (ICT-01)(CHB221) is expressed from CHO. The heavy chain type is IgG1, and the light chain type is…
Molecular-cancer/content/12/1/Page 15 of200 M, then incubated for 1 h at 37 in culture medium containing 70 g/ml of Neutral Red solution (Sigma). Cells had been washed three times with PBS…
Etastasis of breast cancer cells by means of activating mTORC2/Akt/FOXO3a signaling pathway. Cell Death. Dis. 2013; four:e842:e842. 16. Walker CL, et al. Systemic bisperoxovanadium activates Akt/mTOR, reduces autophagy, and enhances…
Otypic differences. In contrast to genetic modifications of cell populations, there was little time for the cell to compensate for kinase activation ahead of observation. SignificanceSrc loved ones kinases (SFKs),…
Product Name : Anti-TSLP Reference Antibody (tezepelumab)synonym : null,productDescription : Anti-TSLP Reference Antibody (tezepelumab)(CHB216) is expressed from CHO. The heavy chain type is huIgG2, and the light chain type is…
Product Name : Anti-TPBG Reference Antibody (ASN004)synonym : null,productDescription : Anti-TPBG Reference Antibody (ASN004) is expressed from CHO. The antibody type is ScFv（huIgG1）. It has a predicted MW of 106.7…
Product Name : Anti-IFNAR1 Reference Antibody (Medarex patent anti-IFNAR-1)synonym : null,productDescription : Anti-IFNAR1 Reference Antibody (Medarex patent anti-IFNAR-1)(CHB212) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-CD19 Reference Antibody (obexelimab)synonym : null,productDescription : Anti-CD19 Reference Antibody (obexelimab)(CHB213) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-TGFb1 Reference Antibody (Genzyme patent anti-TGF-β)synonym : null,productDescription : Anti-TGFb1 Reference Antibody (Genzyme patent anti-TGF-β)(CHB215) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-CSF1R / M-CSFR / CD115 Reference Antibody (axatilimab)synonym : null,productDescription : Anti-CSF1R / M-CSFR / CD115 Reference Antibody (axatilimab)(CHB207) is expressed from CHO. The heavy chain type…
Product Name : Anti-CEACAM5 / CEA / CD66e Reference Antibody (Immunomedics patent anti-CEACAM5 (Class III))synonym : null,productDescription : Anti-CEACAM5 / CEA / CD66e Reference Antibody (Immunomedics patent anti-CEACAM5 (Class III))(CHB209)…
Product Name : Anti-GD2 Reference Antibody (naxitamab)synonym : null,productDescription : Anti-GD2 Reference Antibody (naxitamab)(CHB210) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-GLP1R Reference Antibody (Centocor patent anti-GLP-1R)synonym : null,productDescription : Anti-GLP1R Reference Antibody (Centocor patent anti-GLP-1R)(CHB206) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-INHAMouse mAbsynonym : null,productDescription : NonemolecularWeight : 40endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are immunoglobulins…
N-acetylation necessary for ERAD-L|We conclude that N-terminal acetylation of Der1, even though crucial for Der1 activity in ERAD-L, is unlikely to cause a significant change in Der1 dimerization, affinity for…
In animals on each standard salt and higher salt diets (21, 22). The sturdy association between pNa and BP in older females may be explained by the depletion of estrogen.…
Confident, a forward selection procedure is employed where one of the most significant association is iteratively added to the model, with p-values computed employing the likelihood ratio test. Statistical significance…
Product Name : Anti-VEGF Reference Antibody (BioMab patent anti-VEGF)synonym : null,productDescription : Anti-VEGF Reference Antibody (BioMab patent anti-VEGF)(CHB205) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-ERBB2 / HER2 / CD340 Reference Antibody (BioMab patent anti-Her2)synonym : null,productDescription : Anti-ERBB2 / HER2 / CD340 Reference Antibody (BioMab patent anti-Her2)(CHB204) is expressed from CHO.…
Product Name : Anti-CTLA-4 / CD152 Reference Antibody (Antitope patent anti-CTLA4)synonym : null,productDescription : Anti-CTLA-4 / CD152 Reference Antibody (Antitope patent anti-CTLA4)(CHB203) is expressed from CHO. The heavy chain type…
Product Name : Anti-Amyloid Beta Reference Antibody (bapineuzumab)synonym : null,productDescription : Anti-Amyloid Beta Reference Antibody (bapineuzumab)(CHB201) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-Amyloid Beta Reference Antibody (lecanemab)synonym : null,productDescription : Anti-Amyloid Beta Reference Antibody (lecanemab)(CHB202) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-VEGFR2 / KDR / CD309 Reference Antibody (vulinacimab)synonym : null,productDescription : Anti-VEGFR2 / KDR / CD309 Reference Antibody (vulinacimab)(CHB198) is expressed from CHO. The heavy chain type…
Product Name : Anti-VEGFR3 / FLT4 Reference Antibody (LY3022856)synonym : null,productDescription : Anti-VEGFR3 / FLT4 Reference Antibody (LY3022856)(CHB199) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-VEGFR2 / KDR / CD309 Reference Antibody (alacizumAb)synonym : null,productDescription : Anti-VEGFR2 / KDR / CD309 Reference Antibody (alacizumAb)(CHB196) is expressed from CHO. The heavy chain type…
Product Name : Anti-VEGFR2 / KDR / CD309 Reference Antibody (AT001)synonym : null,productDescription : Anti-VEGFR2 / KDR / CD309 Reference Antibody (AT001)(CHB197) is expressed from CHO. The heavy chain type…
Product Name : Anti-IMP3 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 22endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
| www.plosone.orgtions, 240 mg/ml FPKc triggered 65.2062.34 cell viability loss, suggesting some other cytotoxic components current in FPKc. For comparison, Figure 3E reflected the cytotoxicity of FPKc on human regular…
Ites, and traumatic wounds. Arterial, venous, and diabetic leg ulcers Stress ulcers, post-operative wounds, donor and graft web pages and traumatic wounds. Diabetic and infected wounds. To avoid post-operative adhesions…
Product Name : Anti-VEGFA Reference Antibody (varisacumab)synonym : null,productDescription : Anti-VEGFA Reference Antibody (varisacumab)(CHB194) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-VEGFC Reference Antibody (VGX100)synonym : null,productDescription : Anti-VEGFC Reference Antibody (VGX100)(CHB195) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-VCAM1 / CD106 Reference Antibody (Hanwha patent anti-VCAM-1)synonym : productDescription : Anti-VCAM1 / CD106 Reference Antibody (Hanwha patent anti-VCAM-1)(CHB190) is expressed from CHO. The heavy chain type…
Product Name : Anti-Tau Reference Antibody (zagotenemab)synonym : null,productDescription : Anti-Tau Reference Antibody (zagotenemab)(CHB191) is expressed from CHO. The heavy chain type is huIgG4SP, and the light chain type is…
Product Name : Anti-VEGFA Reference Antibody (ranibizumab)synonym : null,productDescription : Anti-VEGFA Reference Antibody (ranibizumab)(CHB193) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-Integrin a5b1 (ITGA5 & ITGB1) Reference Antibody (volociximab)synonym : null,productDescription : Anti-Integrin a5b1 (ITGA5 & ITGB1) Reference Antibody (volociximab)(CHB188) is expressed from CHO. The heavy chain type…
Product Name : Anti-TNFRSF4 / OX40 / CD134 Reference Antibody (vonlerizumab)synonym : null,productDescription : Anti-TNFRSF4 / OX40 / CD134 Reference Antibody (vonlerizumab)(CHB189) is expressed from CHO. The heavy chain type…
Product Name : Anti-TrkB / NTRK2 Reference Antibody (Rinat patent anti-TrkB)synonym : null,productDescription : Anti-TrkB / NTRK2 Reference Antibody (Rinat patent anti-TrkB)(CHB185) is expressed from CHO. The heavy chain type…
Product Name : Anti-TSLP Reference Antibody (Schering patent anti-TSLP)synonym : null,productDescription : Anti-TSLP Reference Antibody (Schering patent anti-TSLP)(CHB186) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-TSPAN26 / CD37 Reference Antibody (AGS67E)synonym : null,productDescription : Anti-TSPAN26 / CD37 Reference Antibody (AGS67E)(CHB187) is expressed from CHO. The heavy chain type is huIgG2, and the…
Sons largely agree amongst estimates depending on OGs and these determined according to the genome size of closely connected organisms (R2 0.86; Supplementary Figure S4) even though genome sizes of…
Ggest that endogenous AA is often a mediator promoting hypoxic vasoconstriction in the rat pulmonary vessels. Moreover, we identified that DAG lipase inhibitors had no effect on the hypoxic response.…
. 27. Boivin G, Lips P, Ott SM, et al. Contribution of raloxifene and calcium and vitamin D3 supplementation for the raise of your degree of mineralization of bone in…
Preclinical model on which cellular therapy for X-linked SCID was created and successfully translated towards the clinical setting (six). The present studies present a protocol that’s adaptable with a doubling…
Assay, ARR18 induced an ARR5:LUC construct by about 50 in the presence of cytokinin (Veerabagu et al., 2012). When ectopically overexpressed in transgenic plants, ARR18 enhanced the cytokinin sensitivity, and…
(Miceli et al., 2009), we decided to investigate irrespective of whether the P574S mutation could impact the localization on the heteromeric KV 7.2/KV 7.three complex.We 1st analyzed the localization of…
Product Name : Anti-Complement C5 Reference Antibody (vilobelimab)synonym : null,productDescription : Anti-Complement C5 Reference Antibody (vilobelimab)(CHB183) is expressed from CHO. The heavy chain type is huIgG4SP, and the light chain…
Product Name : Anti-TPBG Reference Antibody (Wyeth patent anti-5T4)synonym : null,productDescription : Anti-TPBG Reference Antibody (Wyeth patent anti-5T4)(CHB184) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-IgM Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 49endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-TNFSF5 / CD40L / CD154 Reference Antibody (ruplizumab)synonym : null,productDescription : Anti-TNFSF5 / CD40L / CD154 Reference Antibody (ruplizumab)(CHB180) is expressed from CHO. The heavy chain type…
Product Name : Anti-TIGIT Reference Antibody (vibostolimab)synonym : null,productDescription : Anti-TIGIT Reference Antibody (vibostolimab)(CHB182) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-TNFSF2 / TNFa Reference Antibody (hMAK195)synonym : null,productDescription : Anti-TNFSF2 / TNFa Reference Antibody (hMAK195)(CHB173) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-STEAP1 Reference Antibody (vandortuzumAb)synonym : null,productDescription : Anti-STEAP1 Reference Antibody (vandortuzumAb)(CHB175) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-Integrin a4b7 (ITGA4 & ITGB7) Reference Antibody (vedolizumab)synonym : null,productDescription : Anti-Integrin a4b7 (ITGA4 & ITGB7) Reference Antibody (vedolizumab)(CHB178) is expressed from CHO. The heavy chain type…
Product Name : Anti-TNFSF2 / TNFa Reference Antibody (CMAB008)synonym : null,productDescription : Anti-TNFSF2 / TNFa Reference Antibody (CMAB008)(CHB171) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-TNFSF2 / TNFa Reference Antibody (ESBA 105)synonym : null,productDescription : Anti-TNFSF2 / TNFa Reference Antibody (ESBA 105)(CHB172) is expressed from CHO. The heavy chain type is huIgG1,…
Lls had been cultured and cell lysates have been prepared for immunoblotting or immunoprecipitation analyses related to that described previously (15,29). Methylcellulose colony formation assay was performed as described (29).…
Enterococcus) had been absent or in low abundance (i.e., , 1 of culturable bacteria). Additionally, within the most polymicrobial infection (CF-8), eight taxa of Streptococcus comprised 92 in the culturable…
OnedFigure 12. 7KCh induces important ER pressure markers and SA inhibits this response. ARPE19 cells were treated with eight mM 7KCh for 24 hr and also the mRNA inductions from…
Velocity and amplitude (Bhat et al., 2001). These electrophysiological adjustments are observed in all paranodal mutants and are believed to result from a mixture of current leakage and loss of…
S, respectively ( p 0.0001, Fig 1A and B, and Supporting Details Fig S1). Circulating TEM numbers were substantially larger in CLI sufferers (i.e. those with ischemic rest pain or…
Product Name : Anti-IgG4 Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 36endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-Amyloid Beta Reference Antibody (U.Zurich patent anti-Amyloid Beta)synonym : null,productDescription : Anti-Amyloid Beta Reference Antibody (U.Zurich patent anti-Amyloid Beta)(CHB170) is expressed from CHO. The heavy chain type…
Product Name : Anti-TNFSF13B / BAFF / CD257 Reference Antibody (tabalumab)synonym : null,productDescription : Anti-TNFSF13B / BAFF / CD257 Reference Antibody (tabalumab)(CHB167) is expressed from CHO. The heavy chain type…
Product Name : Anti-TNFSF14 / LIGHT / CD258 Reference Antibody (SAR252067)synonym : null,productDescription : Anti-TNFSF14 / LIGHT / CD258 Reference Antibody (SAR252067)(CHB168) is expressed from CHO. The heavy chain type…
Product Name : Anti-TNFSF2 / TNFa Reference Antibody (CDP571)synonym : null,productDescription : Anti-TNFSF2 / TNFa Reference Antibody (CDP571)(CHB169) is expressed from CHO. The heavy chain type is huIgG4SP, and the…
Product Name : Anti-MICB Reference Antibody (U.Washington patent anti-MICB)synonym : null,productDescription : Anti-MICB Reference Antibody (U.Washington patent anti-MICB)(CHB164) is expressed from CHO. The heavy chain type is huIgG2, and the…
Product Name : Anti-TNFSF13 / APRIL / CD256 Reference Antibody (sibeprenlimab)synonym : null,productDescription : Anti-TNFSF13 / APRIL / CD256 Reference Antibody (sibeprenlimab)(CHB165) is expressed from CHO. The heavy chain type…
Product Name : Anti-DCSTAMP Reference Antibody (U.Rochester patent anti-DC-STAMP)synonym : null,productDescription : Anti-DCSTAMP Reference Antibody (U.Rochester patent anti-DC-STAMP)(CHB160) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-TNFSF1 / TNFb Reference Antibody (pateclizumab)synonym : null,productDescription : Anti-TNFSF1 / TNFb Reference Antibody (pateclizumab)(CHB161) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-GAD65 Reference Antibody (U.Washington patent anti-GAD65)synonym : null,productDescription : Anti-GAD65 Reference Antibody (U.Washington patent anti-GAD65)(CHB163) is expressed from CHO. The heavy chain type is huIgG1, and the…
Ints and stored in RNAlater (Invitrogen AM7020) for 24 h at four (for RNA purification) or fixed in formalin overnight at four for subsequent histological evaluation.The abbreviation utilised is: TPA,…
Lishment of latent infection, gene expression is limited to a gene situated within the long repeat components from the viral genome. Transcription of this gene benefits in generation of your…
Th TBSTween 0.1 and incubated with the appropriate horseradish peroxidase conjugated secondary antibody, followed by five occasions wash in TBS/Tween 0.1 . Proteins had been visualized utilizing enhanced chemoluminescence technology,…
Ein bindJOURNAL OF BIOLOGICAL CHEMISTRYEXPERIMENTAL PROCEDURES Cells and Reagents–THP-1 (National Centre for Cell Science (NCCS), India) cells had been maintained in RPMI 1640 medium (Gibco) with 10 FBS (Gibco), one…
LsonPagemeasurement noise inside the CFSE data . Fitting the model to T cell proliferation data it was located that the most beneficial fits had been obtained with distinct probabilities of…
Levels within the perinatal period, considerably escalating the preterm infant’s risk of building invasive illness (266). Infants with early-onset sepsis may very well be septic resulting from their prematurity, or…
Product Name : Anti-TNFRSF5 / CD40 Reference Antibody (ravagalimab)synonym : null,productDescription : Anti-TNFRSF5 / CD40 Reference Antibody (ravagalimab)(CHB159) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-IgG Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 36endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-TNFRSF5 / CD40 Reference Antibody (mitazalimab)synonym : null,productDescription : Anti-TNFRSF5 / CD40 Reference Antibody (mitazalimab)(CHB158) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-TNFRSF5 / CD40 Reference Antibody (iscalimab)synonym : null,productDescription : Anti-TNFRSF5 / CD40 Reference Antibody (iscalimab)(CHB156) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-TNFRSF5 / CD40 Reference Antibody (lucatumumab)synonym : null,productDescription : Anti-TNFRSF5 / CD40 Reference Antibody (lucatumumab)(CHB157) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-IL-33 Reference Antibody (torudokimab)synonym : null,productDescription : Anti-IL-33 Reference Antibody (torudokimab)(CHB148) is expressed from CHO. The heavy chain type is huIgG4SP, and the light chain type is…
Product Name : Anti-IL-33 Reference Antibody (tozorakimab)synonym : null,productDescription : Anti-IL-33 Reference Antibody (tozorakimab)(CHB149) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-Amyloid Beta Reference Antibody (U.Illinois scFv59)synonym : null,productDescription : Anti-Amyloid Beta Reference Antibody (U.Illinois scFv59)(CHB153) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-PDCD1 / PD-1 / CD279 Reference Antibody (toripalimab)synonym : null,productDescription : Anti-PDCD1 / PD-1 / CD279 Reference Antibody (toripalimab)(CHB146) is expressed from CHO. The heavy chain type…
Product Name : Anti-TNFRSF4 / OX40 / CD134 Reference Antibody (BMS-986178)synonym : null,productDescription : Anti-TNFRSF4 / OX40 / CD134 Reference Antibody (BMS-986178)(CHB147) is expressed from CHO. The heavy chain type…
To a reaction mixture containing 20 M of phenol red (sodium salt), 1mM H2O2 and ten mM NaBr. The oxidation of ferric enzyme with NaOBr or NaOCl was performed by…
Sport proteins whose expression is regulated by numerous environmental stimuli. They underline the requirement to assess biotransformation effectiveness, both when it comes to substrate utilisation and item formation, in several…
Ogens typically on account of inherent genetic issues, Niacin deficiency on the other hand is definitely an instance of environmental element deficiency top to neural degenerative course of action. On…
Mpler (Chemical Information Systems, Oxford, PA, USA) attached to a PerkinElmer GC/MS apparatus (Clarus 560, PerkinElmer, Waltham, MA, USA) applying a 30 0.25 mm column (film thickness 0.25 m). The…
Sidue within the equivalent position to Arg203. (MLK3 numbering) This group was recognized inside ourNIH-PA Author Manuscript NIH-PA Author Manuscript NIH-PA Author ManuscriptJ Med Chem. Author manuscript; accessible in PMC…
Hanks buffer remove unbound mAbs and incubated on ice with 1 : 1000 dilution of Alexa fluor 488-labeled goat anti-mouse IgG in Hanks/BSA for 1 h. The cells had been…
Product Name : Anti-ERBB1 / EGFR / HER1 Reference Antibody (tomuzotuximab)synonym : null,productDescription : Anti-ERBB1 / EGFR / HER1 Reference Antibody (tomuzotuximab)(CHB141) is expressed from CHO. The heavy chain type…
Product Name : Anti-CAPRIN1 Reference Antibody (Toray patent anti-Caprin-1)synonym : null,productDescription : Anti-CAPRIN1 Reference Antibody (Toray patent anti-Caprin-1)(CHB144) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-IgD Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 42endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-TNFRSF10B / TRAILR2 / CD262 Reference Antibody (lexatumumab)synonym : null,productDescription : Anti-TNFRSF10B / TRAILR2 / CD262 Reference Antibody (lexatumumab)(CHB140) is expressed from CHO. The heavy chain type…
Product Name : Anti-TF / Factor III / Tissue Factor / CD142 Reference Antibody (TNX-832)synonym : productDescription : Anti-TF / Factor III / Tissue Factor / CD142 Reference Antibody (TNX-832)(CHB137)…
Product Name : Anti-TNFRSF10B / TRAILR2 / CD262 Reference Antibody (benufutamab)synonym : null,productDescription : Anti-TNFRSF10B / TRAILR2 / CD262 Reference Antibody (benufutamab)(CHB138) is expressed from CHO. The heavy chain type…
Product Name : Anti-TCR Reference Antibody (TOL101)synonym : null,productDescription : Anti-TCR Reference Antibody (TOL101)(CHB139) is expressed from CHO. The heavy chain type is huIgG2, and the light chain type is…
Product Name : Anti-TF / Factor III / Tissue Factor / CD142 Reference Antibody (Chugai patent anti-TF)synonym : productDescription : Anti-TF / Factor III / Tissue Factor / CD142 Reference…
Product Name : Anti-TNFRSF10B / TRAILR2 / CD262 Reference Antibody (tilogotamab)synonym : null,productDescription : Anti-TNFRSF10B / TRAILR2 / CD262 Reference Antibody (tilogotamab)(CHB136) is expressed from CHO. The heavy chain type…
Product Name : Anti-Tau Reference Antibody (tilavonemab)synonym : null,productDescription : Anti-Tau Reference Antibody (tilavonemab)(CHB133) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Disruption by way of tight junction translocation and cytoskeletal reorganization in the human bronchial adenocarcinoma cell line Calu-3 . PE disables PAR-2 in respiratory epithelial cells . Protease-activated receptors (PARs)…
N enhanced danger of establishing subsequent autoimmune diseases (rheumatoid arthritis, a number of sclerosis, inflammatory bowel disease, systemic lupus erythematosus) in depressed individuals (Andersson et al., 2015; Dickens et al.,…
Man renal cell carcinoma , and glioblastomas . RPLPO and TBP also belonged to one of the most stably expressed genes in breast carcinomas . Two other candidates which have…
Ernally located polyester that is certainly being cleaved by the enzyme might reside in the vicinity of the hydrophobic interactions using the L825 residue.Cell Rep. Author manuscript; accessible in PMC…
F8300DsarA and SF8300DsaeRS. Transcripts of each psma and RNAIII wereAlpha-type PSMs are Needed for Intracellular VirulencePSMs are core genome-encoded amphipathic peptides which have been connected with CA-MRSA virulence in animal…
Product Name : Anti-Complement C5 Reference Antibody (tesidolumab)synonym : null,productDescription : Anti-Complement C5 Reference Antibody (tesidolumab)(CHB130) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-CSF2 / GM-CSF Reference Antibody (Theraclone patent anti-GM-CSF)synonym : null,productDescription : Anti-CSF2 / GM-CSF Reference Antibody (Theraclone patent anti-GM-CSF)(CHB132) is expressed from CHO. The heavy chain type…
Product Name : Anti-TIGIT Reference Antibody (etigilimab)synonym : null,productDescription : Anti-TIGIT Reference Antibody (etigilimab)(CHB129) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-TGM2 / Transglutaminase 2 Reference Antibody (zampilimab)synonym : null,productDescription : Anti-TGM2 / Transglutaminase 2 Reference Antibody (zampilimab)(CHB127) is expressed from CHO. The heavy chain type is huIgG4SP,…
Product Name : Anti-IDH-1 Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 47endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-Tenascin C Reference Antibody (tenatumomab)synonym : null,productDescription : Anti-Tenascin C Reference Antibody (tenatumomab)(CHB122) is expressed from CHO. The heavy chain type is huIgG2, and the light chain…
Product Name : Anti-TFPI Reference Antibody (marstacimab)synonym : null,productDescription : Anti-TFPI Reference Antibody (marstacimab)(CHB124) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-TGFb1 Reference Antibody (NIS793)synonym : null,productDescription : Anti-TGFb1 Reference Antibody (NIS793)(CHB126) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-TNFRSF4 / OX40 / CD134 Reference Antibody (telazorlimab)synonym : null,productDescription : Anti-TNFRSF4 / OX40 / CD134 Reference Antibody (telazorlimab)(CHB121) is expressed from CHO. The heavy chain type…
Product Name : Anti-TCR Reference Antibody (NKTT320)synonym : null,productDescription : Anti-TCR Reference Antibody (NKTT320)(CHB118) is expressed from CHO. The heavy chain type is huIgG4, and the light chain type is…
Remedy (SK-5300, Vector Blue). They had been then incubated using a rabbit anti-active caspase-3 antibody (17 kD, 1:100 dilution, AB3623 Chemicon) for 1.five h at 37 and washed with DPBS.…
Ce, a situation that impairs voltage control. To overcome this problem, we applied an approach previously employed by other authors (e.g., Deak et al. 2000) in which ramp depolarizations are…
D DNA synthesis by blocking uridine transport, as a result, inhibiting the pyrimidine salvage pathway . In our study, C57BL/6J mice with dietary uridine supplementation or UPase1-/-mice with elevated endogenous…
Of HIC in any purification method presents two primary challenges. Generally, binding capacity has been traditionally restricted on HIC, in particular in comparison to ion exchange chromatography (IEX).10,11 Resin vendors…
Ophobic and charged residues may mediate the NLRP3 inflammasome assembly (28). Could these AIM2-specific hydrophobic and charged residues also play a role in mediating PYD-PYD interactions Polar and Hydrophobic Interactions…
Nin-8 (CCK-8) (Degorter et al., 2012), suggesting that these amino acids are certainly involved in substrate recognition or transport by OATP1B3. These research are crucial since they will enable to…
Product Name : Anti-TBFbR2 Reference Antibody (LY3022859)synonym : null,productDescription : Anti-TBFbR2 Reference Antibody (LY3022859)(CHB117) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-Integrin a2b3 (ITGA2 & ITGB3) Reference Antibody (tadocizumab)synonym : null,productDescription : Anti-Integrin a2b3 (ITGA2 & ITGB3) Reference Antibody (tadocizumab)(CHB112) is expressed from CHO. The heavy chain type…
Product Name : Anti-Tau Reference Antibody (bepranemab)synonym : null,productDescription : Anti-Tau Reference Antibody (bepranemab)(CHB113) is expressed from CHO. The heavy chain type is huIgG4SP, and the light chain type is…
Product Name : Anti-PCSK9 Reference Antibody (tafolecimab)synonym : null,productDescription : Anti-PCSK9 Reference Antibody (tafolecimab)(CHB115) is expressed from CHO. The heavy chain type is huIgG2, and the light chain type is…
Product Name : Anti-HSA Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 49endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are…
Product Name : Anti-Sphingosine-1-phosphate Reference Antibody (sonepcizumab)synonym : null,productDescription : Anti-Sphingosine-1-phosphate Reference Antibody (sonepcizumab)(CHB110) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-SLC2A8 Reference Antibody (VB1-050)synonym : null,productDescription : Anti-SLC2A8 Reference Antibody (VB1-050)(CHB104) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-NaPi2b / SLC34A2 Reference Antibody (upifitamab)synonym : null,productDescription : Anti-SLC34A2 Reference Antibody (upifitamab)(CHB106) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-Amyloid Beta Reference Antibody (solanezumab)synonym : null,productDescription : Anti-Amyloid Beta Reference Antibody (solanezumab)(CHB107) is expressed from CHO. The heavy chain type is huIgG1, and the light chain…
Product Name : Anti-SLAMF7 / CS1 Reference Antibody (PDL241)synonym : null,productDescription : Anti-SLAMF7 / CS1 Reference Antibody (PDL241)(CHB103) is expressed from CHO. The heavy chain type is huIgG1, and the…
The anti-tumor activity of 5-FU by apoptosis, inhibition of proliferation and colony formation of HCT116 and HCT116R cells in 3D alginate beadsTo examine, no matter if curcumin can enhance the…
Ss could lead to Fas-mediated apoptosis. Nevertheless, the JNK pathway can also be involved in non-apoptotic responses such as macrophagePLOS A single | www.plosone.orgdifferentiation and proinflammatory cytokine and chemokine production…
Tively impacts cardiac glucose uptake and insulin sensitivity following ischemic injury and eventually results in the development of heart failure (Ciccarelli et al., 2011; Evron et al., 2012). The truth…
Mann et al., 2012) have been decrease than reported in preceding studies. Two of these research used unilateral autologous transplantation of testicular cells in adult cynomolgus monkeys right after 2…
Onds sustaining the structures with the ECD linker domain plus the ECLs within the SMO receptor are highly preserved in the FZD receptors (the only exception is FZD4, of which…
G of sodium citrate in 1000 mL of DEPC-treated water. paraformaldehyde (PFA) for 15 min at room temperature followed by two washes with PBS for five min each at room…
Product Name : Anti-SLAMF7 / CS1 Reference Antibody (azintuxizumAb)synonym : null,productDescription : Anti-SLAMF7 / CS1 Reference Antibody (azintuxizumAb)(CHB102) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-Siglec-2 / CD22 Reference Antibody (NCI m972)synonym : null,productDescription : Anti-Siglec-2 / CD22 Reference Antibody (NCI m972)(CHB098) is expressed from CHO. The heavy chain type is huIgG1,…
Product Name : Anti-Siglec-2 / CD22 Reference Antibody (pinatuzumab)synonym : null,productDescription : Anti-Siglec-2 / CD22 Reference Antibody (pinatuzumab)(CHB099) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-Siglec-3 / CD33 Reference Antibody (IMGN779)synonym : null,productDescription : Anti-Siglec-3 / CD33 Reference Antibody (IMGN779)(CHB100) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-Siglec-2 / CD22 Reference Antibody (epratuzumab)synonym : null,productDescription : Anti-Siglec-2 / CD22 Reference Antibody (epratuzumab)(CHB096) is expressed from CHO. The heavy chain type is huIgG4SP, and the…
Product Name : Anti-Siglec-2 / CD22 Reference Antibody (NCI m971)synonym : null,productDescription : Anti-Siglec-2 / CD22 Reference Antibody (NCI m971)(CHB097) is expressed from CHO. The heavy chain type is huIgG1,…
Product Name : Anti-Siglec-15 / CD33L3 Reference Antibody (AB-25E9)synonym : null,productDescription : Anti-Siglec-15 / CD33L3 Reference Antibody (AB-25E9)(CHB093) is expressed from CHO. The heavy chain type is huIgG2, and the…
Product Name : Anti-Siglec-15 / CD33L3 Reference Antibody (Medimmune patent anti-Siglec-15)synonym : null,productDescription : Anti-Siglec-15 / CD33L3 Reference Antibody (Medimmune patent anti-Siglec-15)(CHB094) is expressed from CHO. The heavy chain type…
Product Name : Anti-HNF1 Beta Rabbit mAbsynonym : null,productDescription : NonemolecularWeight : 61endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies…
Product Name : Anti-BST2 / CD317 Reference Antibody (SBI Biotech patent anti-BST2)synonym : null,productDescription : Anti-BST2 / CD317 Reference Antibody (SBI Biotech patent anti-BST2)(CHB092) is expressed from CHO. The heavy…
A schematic form a summary on the strongest baseline predictors of your gains in body weight, total adiposity, the FM-to-FFM ratio, or BE content. The upper section of the figure…
Nmethylated, respectively (Zilberman et al., 2007). Determined by the information from Zilberman et al. (2007), genes with DNA methylation have been substantially enriched among the unregulated genes in vim1/2/3 (Supplemental…
Nditions, WT mice showed typical regenerating crypts (Figure 3D). Further determination on the proliferation and apoptosis showed sharply decreased cell proliferation whileNIH-PA Author Manuscript NIH-PA Author Manuscript NIH-PA Author ManuscriptGut.…
The existing SP resistance according to quintuple mutations in Tanzania.in every single experiment. Digestion items had been eluted on 2 agarose gel (Invitrogen, USA) stained with ethidium bromide and visualized…
In IL-1 production, as a result indicating its role in the production from the inflammatory cytokine. A considerable boost in IRAK4 expression was also observed, hence confirming the induction of…
Taneously increase even if assigned to placebo. These situations make it difficult two to demonstrate substantial variations among active drugs and placebo. Thus, in this study, the principle outcome measure…
Product Name : Anti-RTN4 / NOGO Reference Antibody (atinumab)synonym : null,productDescription : Anti-RTN4 / NOGO Reference Antibody (atinumab)(CHB088) is expressed from CHO. The heavy chain type is huIgG4SP, and the…
Product Name : Anti-RTN4 / NOGO Reference Antibody (NG-101)synonym : null,productDescription : Anti-RTN4 / NOGO Reference Antibody (NG-101)(CHB090) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-S100A4 Reference Antibody (LK-1)synonym : null,productDescription : Anti-S100A4 Reference Antibody (LK-1)(CHB091) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is…
Product Name : Anti-RAMP3 Reference Antibody (Medella patent anti-RAMP-3)synonym : null,productDescription : Anti-RAMP3 Reference Antibody (Medella patent anti-RAMP-3)(CHB084) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-RHD / CD240d Reference Antibody (LFB Anti-RhD)synonym : null,productDescription : Anti-RHD / CD240d Reference Antibody (LFB Anti-RhD)(CHB085) is expressed from CHO. The heavy chain type is huIgG1,…
Product Name : Anti-PMELMouse mAbsynonym : null,productDescription : NonemolecularWeight : 70endotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : concentration : Ready-to-useAntibodies are immunoglobulins…
Product Name : Anti-Amyloid Beta Reference Antibody (Rockefeller U. patent anti-Amyloid Beta)synonym : null,productDescription : Anti-Amyloid Beta Reference Antibody (Rockefeller U. patent anti-Amyloid Beta)(CHB079) is expressed from CHO. The heavy…
Product Name : Anti-RHD / CD240d Reference Antibody (roledumab)synonym : null,productDescription : Anti-RHD / CD240d Reference Antibody (roledumab)(CHB081) is expressed from CHO. The heavy chain type is huIgG1, and the…
Product Name : Anti-Bcl-2 Mouse mAbsynonym : productDescription : NonemolecularWeight : 18 kDaendotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : Humanconcentration : Ready-to-useAntibodies…
Product Name : Anti-ATRX Mouse mAbsynonym : null,productDescription : NonemolecularWeight : 283 kDaendotoxin : Nonepurity : Noneformulation : 1×PBS, pH 7.4storage : Maintain refrigerated at 2-8℃.reactivity : Humanconcentration : Ready-to-useAntibodies…
Atient has suffered from low progressive skeletal myopathy considering that childhood. Considering that five years he have has progressive muscular weakness, frequent episodes of falling. Inside the age of six…
N PFS by investigator assessment.* Univariate analysis Baseline variable Remedy (lenalidomide versus IC) MIPI-based qualities MIPI score at diagnosis (high versus low/intermediate) MIPI score at baseline (high versus low/intermediate) Age,…
H ahead of TGI, Total proteins have been isolated from the hippocampal CA1 subfield of sham-operated controls, handle siRNA with TGI, or Drp1 siRNA with TGI for protein oxidation in…
E full receptor occupancy and degradation. Hence, we investigated the effects of FTY720 treatment method along with NPC therapy in the viral model of MS. Herein, we display that FTY720…
Ent of spontaneous seizures after SEAuthor Manuscript Writer Manuscript Writer Manuscript Writer ManuscriptAlthough the time period among SE plus the appearance from the very first spontaneous behavioral seizure is termed…
Ells is induced through the early phase of CSFV infection, indicating that CSFV can activate the JAK-STAT pathway. In addition, we demonstrate that MEK2 no longer influences CSFV replication after…
Seedlings below non-HS situations. The information had at the least three biological replicates and have been tested using Duncan,s multiple-range test at 0.05 significant level, which denote indicates typical error…
Samples have been kept protected from light for 24 h at RT just before analysis. Imaging was performed by a Nikon Eclipse Ti2-A inverted microscope equipped with ReScan confocal microscopic…
Pattern recognition molecules (PRMs) to their ligands, i.e., binding of C1q to antigenantibody complexes within the CP activation and binding of mannose-binding lectin (MBL), ficolins, collectin liver 1 (CLL1 or…
F protein crowders (A and B) Diffusion coefficients (A) and images from confocal microscopy (B) of fluorescein in DMSO or PBS with or without Tween 20. (C and D) Comparative…
Hich was accompanied by the reversal of EMT as well as the suppression of your invasion phenotype in MDA-MB-231 cells. These findings implicated that quercetinORIGINAL ARTICLEJOURNAL OF Food AND DRUG…
Logy in Tg (PCSK9) mice indicates the lack of PCSK9 influences testicular function and could lower fertility in mice. IL-17A and insulin are implicated inside the deregulation of spermatogenesis and…
The COVID-19 pandemic. Supplementary data to this short article can be identified online at doi. org/10.1016/j.scitotenv.2022.160322. CRediT authorship contribution statement Muhammad Tariq Khan: Writing original draft, Writing assessment editing, Conceptualization.…
Inciple components of ancestry working with details from select CpG web-sites (32). To adjust for batch effects in the DNAm measurement, plate quantity was included as a covariate in the…
Carrier 19 loved ones (SLC19) of transporters which conform for the main facilitator superfamily (MFS) fold3,18. SLC19 has three members (A1-A3); SLC19A1 (RFC) exchanges anions, whereas SLC19A2 and A3 (ThTr1…
Enough to alleviate discomfort in OA, and opioids can make considerable adverse effects including nausea, dizziness, somnolence, respiratory depression, and vomiting. Thus, an appealing therapeutic target must be further studied.Reactive…
Or in the neurotransmitters. However, even though the transmitter involved inside the activity could be identified, it’s difficult to get the exact place and timing of secretion. If aCopyright: 2023…
D from the DNA damage-induced, p53-dependent WIP1 transcript regulation. The increased WIP1 expression by SQLE inhibition was not linked together with the adjust inside the level of protein stability as…
Vitro 3.three. ADAR2 Prevents Hepatocyte from Lipid Accumulation In VitroTo investigate the effects of ADAR2 on hepatic lipogenesis, loss-of-function and To investigate the effects of ADAR2 on hepatic lipogenesis, loss-of-function…
E high-quality evidence and standardized treatment, as well as the price of utilization of liver transplantation will grow to be reduced.FundingThis project is funded by the National Natural Science Foundation…
Ting (WB) (Figure 4d, Figure S19, Supporting Data), which showed that each SpAcDex-ATMO-21 NPs and B1L@SpAcDex-ATMO21 NPs upregulate PTEN protein expression. The difference in PTEN expression among these two groups…
Against fruit rot pathogens under in vitro conditions; (four) to assess the in vivo antifungal efficacy of liquid formulation and soluble metabolites of prospective actinobacterial isolates on chilli fruits. two.…
Ier survival curves had been derived from the KM plotter database (http://kmplot). The Cox proportional hazards model was utilised to analyse the prognostic value from the variables. The outcomes have…
In Figure six, the sensory evaluation outcomes abA two ten.14 0.30effect on RC-SSP, when all0.02 abB scores 7.34 sensory showed that the addition of AE had a advertising bA 4…
Re AR and virulence genes, respectively. (A) Connections connections. Nodes in orange and blue are AR and virulence genes, respectively. (A) Connections involving phenotypic AR and virulence genes across 50…
Or predicting HVPG 12 mm Hg and hence could pretty predict the presence of EV . Sebastiani et al. suggested APRI at a cutoff worth of 1.four for the prediction…
He crucial point of TBI therapy. EA has an protective effect around the nervous program and immune method, which has analgesic impact, immune regulation, and Organ function protection. Regional rSO2…
D not proliferate through overnight culture, Raji cells slightly proliferated, and Jurkat and JINB8 proliferated by a issue of 3. PMNs remained alive throughout overnight culture but showed a trend…
D) AZD4547. Data are represented as a percentage .E.M.Figure 5. CAM-PDX chemotherapy resistance is concordant with that of pre-NAC MIBC tumors clinically resistant to GC. Brightfield photographs of MIBC chemoresistant…
0 or 1 Offered tumor tissue No prior remedy for advanced gastric/GEJ cancer Stratification Geographic area PD-L1 CPS Mixture chemotherapyPembrolizumab 200 mg IV Q3W + Chemotherapy (FP or CAPOX) Randomized…
3 mg/ml) as substrates. A. xylosoxidans ATCC 27061 and P. aeruginosa ATCC 27853 had been incorporated as unfavorable controls and clinical isolates of P. aeruginosa expressing IMP-13 or VIM-2 metallo-lactamases…
Quantity of ATPBonferr test: chi square = 34.587, df = three, p = 0.025). (C) Inside the steady-state sham group, an appropr of ATP level was maintained, whereas within the…
Ting Facts: Appendix S2. NVivo 12 application (QSR International) was applied to boost the organization, management, visualization and reporting of data.Participant sociodemographic characteristicsParticipants (n = 15)Sociodemographic characteristics Gender (n=) Female…
Ed employing Byologic computer software (Protein Metrics Inc., San Carlos, CA), which utilizes extracted ion chromatogram areas (XIC regions). The XIC is automated by Byologic from the Byonic search outcomes…
Y was performed in 1956, however the official transplant system was only six years old when our patient was transplanted in 1974. Brief and long-term outcome following kidney transplantation within…
N a multidimensional no cost power surface implicit of solvent coordinates primarily based around the solute FEG derived from explicit QM/MM simulations. To decrease the computational costs of figuring out…
90).Fc Oglycosylation from human IgG usion glycoproteinsThe IgG Fc is a homodimer connected by an inter-chain disulfide-bond (CH2 domain) and non-covalently paired area (CH3 domains) . It is well-established that…
Ing MBNL1 (Muscleblind Like Splicing Regulator 1) expression enhancers, and toxic RNA degradation . It was also lately reported that therapy of DM1 patient-derived fibroblasts with metformin reversed metabolic and…
On for 8 weeks, the learning and memory capacity of your mice in the OE group was substantially larger than that inside the OC group (p 0.05) (Figure 2C). These…
Ne ASCT and reserve it for progressive disease. Lastly, while consolidation therapy post transplantation could induce deeper response prices, for the majority of patients, relapse remains inevitable, generating the case…
In the PES minima. For example, it was shown that has two accessible steady conformations, cis and trans, whereas for the cis conformers are much larger in power and thus…
Ubchondral bone may behave as a disease-modifying part in the progression of knee OA. Within this study, ESWT posed improved analgesic effect and functional score improvement in the therapy of…
N the presence of Ca2+ ions, alginate solutions can form gels by cooperative interaction in between Ca2+ with blocks of guluronic units (G-blocks) of SA to form ionic bridges in…
E range; HTN = hypertension; HLD = hyperlipidemia; DM = Diabetes Mellitus; CAD = coronary Mellitus; CAD = coronary artery disease; CHF = Congestive Heart Failure; CKD: chronic kidney artery…
Processes mainly because they’re distributed in different immuneresponsive cell subsets that coordinate the adaptive immune processes of T cell priming and expansion and memory T cell formation and survival (9).…
Shown by mean of triplicates EM (left y-axis; break indicates the cut-off in the assay), and emergence of substitutions for ED43-20m (lines) during adaptation following transfection (T; samples not obtainable…
King status (by no means; former; light; moderate and heavy) and also the poverty earnings ratio (PIR) have been all taken into consideration when figuring out socio-demographic qualities. A under…
Corresponding to Asn118 in XEEL. Most structural calcium residues had been located to cluster amongst His115 and Asp127, having a HENXXXGXCTXGD consensus sequence. Though not present inside the consensus sequence,…
Showed high levels of proliferation and low background levels of apoptosis (Fig. 7A ). Upon chemotherapy p53 became quickly stabilized in p53+/+ leukemias with an expression peak at two h…
Fluid atmosphere conditions was evaluated by as a consequence of the ploughing of really hard abrasive particles on test steel microcutting mechanism a modified ASTM B611 wet sand rubber wheel…
Ics, and fine targeting properties. This study focused at creating physically stable DOX-LPHNs formulation for augmenting its aqueous solubility and enhancing its oral bioavailability, and compatibility. Eudragit RS-100 (polymer), stearic…
The future, enough amounts of purified MSCs have to be obtained . However, the amount of MSCs gotten from tissues is largely limited, which necessarily requires effective expansion in vitro…
Ferences in human and mouse cardiac electrophysiology, the mechanisms of intracellular Ca2+ regulation are related in between both species. On the other hand, NCX1 features a bigger contribution in humans,…
H the following therapeutic remedy solutions: single dose IV oritavancin, dalbavancin (either as a single 1500 mg dose or two doses: 1000 mg initial dose, followed by 500 mg a…
Atment (EOT) in nonresponders. Tumors of individuals 002-10(12) and 005-11(14) displayed a reduction in size, when these from 005-02 and 005-13 continued to progress. (A) CITE-seq was performed on PBMCs,…
In the initially 1, making use of the stepwise procedure, we determined the percentage of models including every of your initial variables. In the second step, we independently estimated the…
Ens. Secondary endpoints have been hence objective response rate (ORR), illness handle price (DCR), and all round survival (OS). Safety of TEM-based treatment options was assessed by monitoring any adverse…
Patient remained in remission till 2010. In June 2010 patient presented with fever, malaise, and acute abdominal discomfort. Physical examination revealed tenderness in the reduced quadrants in the abdomen, hepatomegaly,…
On to 0 MYH91676-1791 treated cells.by direct interaction with viral GP5 (Li et al., 2018). To additional identify the important area of PRA that is expected for interaction with PRRSV…
M was used for MS acquisition in negative ionization mode. The mass spectrum parameters were identical to these in preceding work (23). Nitrogen was applied for drying, ionization, and collision.…
Ne None None None Three months immediately after ASCT 1.510 14.160 2.950 1.131 five.250 ten.380 36.180 16.670 1.590 Reference values 5.five 015 3.3 two.5 7 34 35 25 four.carbohydrate antigen…
Ation. The present perform was performed by J-GZ in partial fulfillment in the requirements for containing the degree “Dr. rer. biol. hum.”Ethics statementThe studies involving human participants were reviewed and…
Housekeeping genes have been synthesized and procured from Sigma Aldrich. Agarose gel electrophoresis wasS (26) run the amplified product of each and every gene. S (27) utilized to S (31)…
Holesterol, and LDL in patients with patients with hypercholesterolemia, compared with levels developed erides, and LDL in hypercholesterolemia, compared with levels developed by fish oil plus a fish oil and…
The North American Association of Central Cancer Registries Hispanic Identification Algorithm . Due to the fact patients in the cancer registry with unknown birthplace data are far more likely to…
Group ahead of DFT and the mean MAP in the DFT- group were compared. The imply MAP inside ten minutes just before DFT and the imply MAP inside 10 minutes…
Ational mean to be stunted, underweight, or malnourished, respectively. Raw scores obtained in the 4 core subtests from the WISC-IV were converted to agescaled index scores using tables of norms…
OparticlesThe antiretroviral activities of EuCF-DTG and FA-EuCF-DTG nanoparticles were assessed in MDM infected with HIV-1ADA, a prototype macrophagetropic strain . MDM had been treated with nanoparticles at a variety of…
Minority accrual to clinical trials have already been published, the challenge remains to 1st enhance access to the cancer center itself; access barriers to cancer care impact enrollment in clinical…
Lyzed working with Kaplan eier model and Cox proportional hazards models. All estimates are derived from single-variable models, i.e., fold change in only 1 gene was included in every model.…
F the pregnant ladies within the study was 24.7 4.1 years, and quantity of Young children born imply wasPak J Med Sci 2015 Vol. 31 No. three www.pjms.com.pkAbdul Ghaffar et…
On. 2016;38:9. von Meyenn F, Iurlaro M, Habibi E, Liu NQ, Salehzadeh-Yazdi A, Santos F, Petrini E, Milagre I, Yu M, Xie Z, et al. Impairment of DNA methylation maintenance…
Tion 1:1000 (1 h, room temp.). The rinsings of probes in buffered NaCl solution (PBS, 0.1 mol, pH 7.4, 15 min 9 three) were produced in between each and every…
Nism underlying this abdominal pain . Hypersensitivity refers for the increased sensation of stimuli: both allodynia (pain evoked by stimuli which are generally not painful) and hyperalgesia (enhanced response to…
S also led us to find that inhibiting ALDH1A3 led to a lower of pSTAT3. Ultimately we identified that pharmacologically inhibiting EZH2, a lately described STAT3 activator, also diminished STAT3…
Gents that induced a change in pHi or i, statistical evaluation was performed by comparison of values prior to and soon after therapy utilizing paired Student t test. The effect…
Quickly induces muscle insulin resistance for glucose uptake by way of the activation of these pathways. Accordingly, our 1st aim was to figure out regardless of whether the fast development…
D endothelial cells) that we previously developed from sorted CRC cell populations (Isella et al, 2015). Averaging the expression of genes in each signature yielded 3 stromal scores (CAF score,…
On, deregulation of cell survival as well as proliferation, invasion and angiogenesis . Having said that, reactive oxygen species (ROS), which are very abundant beneath oxidative tension circumstances, can also…
Infection and lysis,191 antitumor immune response induction22,23 and acute vascular disruption.24 PexaVec is derived in the normally applied Wyeth vaccine strain (Dryvax Wyeth Laboratories, Dallas, TX, USA). Inside a randomized…
Node metastasis had been significant predictors of PFS. Even so both anti-p53 antibody and IHC of p53 protein negativity didn’t yield any independent predictive components (Table 3).Discussion To our understanding,…
Ctivation on the STINGAugust 2017 Volume 91 Concern 16 e00535-17 jvi.asm.orgDeschamps and KalamvokiJournal of VirologyFIG 7 Model summarizing the immunomodulatory functions of HSV-1 UL46. HSV-1 UL46 interacts with both STING…
E have been walking at 15cm/s. The video photos were recorded and analyzed with TreadScan application (CleverSys). Gait parameters had been calculated for quantitative data analyses. Every mouse received a…
S. Moreover, protein spot 167 also belonged to this pattern in Yunong 3114, when it displayed expression pattern B in Yunong 201.DiscussionIn this study, a Chinese winter wheat cultivar Yunong…
Ory syncytial viruses, exportinsIntroduction: the International Overall health ProblemViral respiratory illness (VRD) benefits inside the hospitalization and deaths every single year of millions of people today worldwide, representing a sizable…
Doped or undoped, are utilised to simulate the unique nearby environments explored by a diffusing proton. The doped method consists of 41-atom supercell alternating YO6 and ZrO6 octahedra, though the…
Th or without having asthma . Increasing proof points to the truth that the presence of atopy confounds the interpretation of elevated FeNO in asthma patients. Studies have shown that…
Herols, IU/kg Lauric acid Myristic acid Palmitic acid Stearic acid LA LA ARA EPA DPA DHA SFAc MUFAd PUFAe (n-6) FAf (n-3) FAg (n-6):(n-3) ratioa b c bTest Food 8.17…
Sease in JHMV-infected mice, regardless if transplanted with GFP-NPCs or taken care of with car (data not shown). We following examined if FTY720 therapy influenced the skill of engrafted NPCs…
T HSCT. There were no mismatches from the ABO blood groups. Taken with each other, the BM findings and final result of the initially HSCT, which include the achievement of…
In DMSO situations). Transient transfection siRNA and mimics. siRNA (MUC1, HIF2A, All Stars Damaging Control) and synthetic miRNA/mimics (hsa-miR455-3 P and -5P) have been purchased from Qiagen. Transient siRNA and…
Erial clearance rates, increases neutrophil surface adhesion molecule expression, enhances neutrophil chemotaxis, reduces burn wound infection rates and prevents necrobiosis in burn wounds to a certain extent (18-20). Also, rhGM-CSF…
Ells treated with recombinant VACVs was analyzed (Table 2). We identified that the cell population using the active caspase-3 and-7 improved because the virus dose improved for both recombinants. The…
Thin five years and as much as 40 inside 10 years in comparison with 20 years inside the nontransplantation setting . HCV-associated graft failure represents essentially the most typical result…
Patient security and also the advancement of Precision Medicine. This new study attempts to demonstrate the usefulness of a novel molecular docking workflow for identifying HLA-B57:01 liable compounds from the…
Ct free-standing LbL films.Materials 2013, six Figure 1. Chemical structure of poly(diallylamine-co-maleic acid) (PDAMA).CHCHH2 CCHCHCHCHCH nCOOH COOHN H2. Experimental Section PSS (MW, 500,000) and an aqueous option (20 ) of…
D blood cells in the urine. When visible it is actually termed gross hematuria and when detected by microscopic examination of the urinary sediment it truly is termed microscopic hematuria…
E with enhanced abiotic anxiety tolerance . The ONAC095-SRDX plants contained an elevated degree of endogenous ABA (Fig. 7g), which may perhaps be resulted from up-regulated expression of ABA biosynthetic…
Ere followed for two years to study the biological causes and functional consequences of depression. This manuscript is often a cross-sectional descriptive evaluation of data from 302 sufferers collected at…
Act as an effective inflammasome inducer soon after their injection into mice. We injected aPNMs after priming with LPS (five ) for 24 hours. Immediately after aPNMs have been subcutaneously…
Ous hemorrhage may have various etiologies, but manifest and occult trauma is most common. If a kid has vitreous hemorrhage without having trauma, physicians must take history and examine each…
SIRT1 protein and cytokines have been detected. Each of the operations of transfection have been performed in accordance with the instructions of Lonza human T cell transfection kit. ELISA to…
Iating the self-association in the lysozyme variants into oligomeric species and subsequently into amyloid fibrils via intermolecular interactions in between the locally unfolded segments of various molecules.12,27,28 A study employing…
HCL-v circumstances showed simultaneous expression of CD5 and CD23. All 9 SMZL cases showed surface immunoglobulin light chain restriction (6 kappa, 3 lambda). SMZL cells in all sufferers were optimistic…
Chlorinated biphenyls (PCBs) are within a category of persistent organic pollutants (POPs) which can present human well being challenges long just after release in to the environment. St evik et…
Events (AEs) were monitored throughout the study. Outcomes: All enrolled sufferers had been integrated within the analysis (n = 191); the majority of patients (90.6 , n = 173/191) completed…
Testing and an alpha of 0.05 was utilised. A log-rank Mantel-Cox test was applied to examine the % of HIV-negative BLT mice between groups of handle mice and mice that…
Rhinitis, and groups C (n = ten, asthma/rotatory manage) and D (n = ten, asthma/ hypergravity) exposed to four weeks of rotation with normogravity (1G) or hypergravity (5G) for the…
To block autophagic flux. Next, dual remedy with CQ and WA plus rapamycin, which induces autophagy by inhibiting MTOR (mechanistic target of rapamycin ), resulted inside a important boost in…
Formation in substituted the bands in 832 cm of =O groups along with the =O chelate stretching of amide I band was aromatic hydrocarbons. Ultimately, the absorption band at 630…
Hemical profile of your animal groups is shown in Table 1. Mice fed an HFHCD gained extra weight and had higher aminotransferases, cholesterol, and LDL-cholesterol in comparison to chow-fed mice…
Of CD in nanomaterials could be used to impart high DTX loading capabilities (Zhao and Astruc, 2012; Wang et al., 2016). Even though canonic CD exhibit some renal toxicity following…
G beads had been used in anti-ER or anti–tubulin antibodies. An anti-rabbit IgG beads were made use of within the absence of N-20 the absence of N-20 anti RIZ1 antibody…
two (three) (4)In all four circumstances, the damaging Gibbs power of reaction values indicate that the reactions can proceed spontaneously. Both of our zinc carbonate solutions (ZC and HZ) possess…
Se re existence.Commented : I rep one, just cropped and locked caption is cut-off since th changed when it converted t(P450 and BLASTn searches of 14383 and 69591), two transcripts…
Equally blocked by either CB1 antagonist AM251 or CB2 antagonist SREqually blocked by either CB1 antagonist AM251 or CB2 antagonist SR144528. In contrast, attenuation of cold allodynia by FAAH inhibitors…
0.05). Regression analysis showed that SGR, FI, FE and PER quadratically responded to improved dietary threonine levels (YSGR = -0.011X2 + 0.277X – 0.160, R2 = 0.989, P 0.05; YFI…
Twelve production fluid samples and each of the cloned sequences had been affiliated with assA/masD genes (Fig. five), but no expected amplification band could possibly be obtained from DNA extract…
H data point ( D). 1 Statistically important difference (P 0.005) between the plasma concentrations of (2S,6S)-HNK and (2R,6R)-HNK observed soon after administration of (S)-Ket and (R)-Ket, respectively.2015 | Vol.…
Ation of immunosuppression drugs, which includes Cyclophosphamide (CY), a chemotherapeutic agent that exhibits a notably diurnal rhythm in toxicity . All these capabilities in the animal model and on the…
Activity against the RET kinase; on the other hand, no selective RET inhibitors have however been developed for clinical use. Several phase II clinical trials have already been initiated to…
Dicated that the general DCR was 27 (95 CI: 130 ) plus the median PFS was 3 months. Having said that, erlotinib, which had fair tolerance, had a fair ORR…
International Journal ofEnvironmental The Chinese Ministry of Health Grant (No. 2013ZX10003006). International Journal ofEnvironmental Study and Public HealthArticleInvestigation on Indoor Air Pollution and Childhood Allergies in Households in Six Chinese…
E body of proof exists demonstrating that n-3 PUFAs can evoke endotheliumdependent NO-mediated relaxation. As an example, EPA was reported to induce calcium-independent increases in NO resulting in relaxation of…
St graft survival (18.0 years) and greatest all round survival (23.two years) and most discounted QALYs (11.29). A regimen comprising induction without having mono- or polyclonal antibodies and maintenance with…
Articles have been 800 nm. Therefore, SN-38/NCs-A showed the ideal tumor accumulation among the three formulations.influence on dissolution, cellular uptake, pharmacokinetics, tissue distribution, and antitumor efficacy in vitro and in…
Giterm=RefSeq) and from expressed sequence tag (EST) contigs (://phrap.org/green_group/est_assembly/human/ gene_number_methods.html). Every mRNA or EST contig was represented on the Hu44K microarray by a single 60 mer oligonucleotide, chosen by the…
4] like Myc . Suggestions advise a strict surveillance protocol in APC , starting from the age of 10-12, by annual colonoscopic examinations. The considerably higher number of adenomas is…
, and increased travel distances. Curcumin remarkably enhanced platform crossing quantity and time spent in the target quadrant, and decreased the travel distance (Figures 1B ). The improvement in memory…
2, P2Y4, and P2Y6 requires activation of calcium-related pathways, at some point leading to phosphorylation of MAP kinases, calmodulin, along with the connected kinases for instance CaMKII (19), STATs (46),…
Y of illnesses, age distribution of population, geographic spread and availability ofTable three. Prime ten presenting complaints in ambulance and non-ambulance groupAmbulance Head injury (12 ) Decrease extremity injury (11…
Rior to FOLFIRI in individuals previously treated with oxaliplatin-based chemotherapy, theRior to FOLFIRI in sufferers previously treated with oxaliplatin-based chemotherapy, the molecular mechanisms underlying this acquiring weren’t clarified. In our…
S had been produced.ORIGINAL RESEARCHInsight and Remedy Outcomes in Schizophrenia: Post-hocS were produced.ORIGINAL RESEARCHInsight and Therapy Outcomes in Schizophrenia: Post-hoc Siglec-10, Human (Biotinylated, R119A, HEK293, His-Avi) evaluation of a Long-term,…
R for Itr1 gene, qIcy2-F and qIcy2-R for IcyR for Itr1 gene, qIcy2-F and qIcy2-R for Icy2 gene and qPIN2-F and qPIN2-R for tomato Pin2 gene (Additional file 1).Tuta absoluta…
N at 4 . The Cathepsin B Protein Storage & Stability sedimented mitochondrial pellet was re-suspended in 50 l ofN at four . The sedimented mitochondrial pellet was re-suspended in…
Genome to make bait-IL-6R alpha Protein MedChemExpress reporter strains. A cDNA library was constructed fromGenome to make bait-reporter strains. A cDNA library was constructed from RNA extracted from trifoliate orange…
The pH of TPP affects the electronegative potential on the moleculeThe pH of TPP affects the electronegative prospective in the molecule in its reaction with free of charge amine groups…
L phased-arrayed head coil. All participants were verbally instructed to stayL phased-arrayed head coil. All participants were verbally instructed to remain nonetheless with their eyes closed to finish a 6-minute…
Articles were 800 nm. Thus, SN-38/NCs-A IL-4, Human showed the most effective tumor accumulationArticles have been 800 nm. As a result, SN-38/NCs-A showed the very best tumor accumulation among the…
PASK IBA 3+ (IBA Streptavidin Magnetic Beads custom synthesis Lifesciences), pFRED143 (Ludwig et al., 1999); pMD2. G, psPAXPASK IBA 3+ (IBA Lifesciences), pFRED143 (Ludwig et al., 1999); pMD2. G, psPAX2,…
Cations of individuals undergoing operations (1). Despite many researches and availability ofCations of individuals undergoing operations (1). In spite of TARC/CCL17 Protein site various researches and availability of various painkillers,…
As shown across species.18,23,24,79 The most prominent phenotype in pls3 KOAs shown across species.18,23,24,79 Probably the most prominent phenotype in pls3 KO yeast is impaired endocytosis.33 Right here, we demonstrate…
Gd-IgA1 than do the cells from HCs, concordantly with the serumGd-IgA1 than do the cells from HCs, concordantly together with the serum levels of Gd-IgA1 in the corresponding donors. The…
Aling from human Serum Albumin/ALB Protein site breast cancer cells. Morin and MST-312 therapy inhibitedAling from human breast cancer cells. Morin and MST-312 treatment inhibited the CSC phenotype in human…
Mice. Values are imply D and are normalized with respect toMice. Values are imply D and are normalized with respect to their 0 Mch (P sirtuininhibitor 0.05, by one-way ANOVA).…
Bsorption of Cy5 at 280 nm (0.05 sirtuininhibitorCy5 absorption at 650 nm), and byBsorption of Cy5 at 280 nm (0.05 sirtuininhibitorCy5 absorption at 650 nm), and by absorption of Cy5…
0.five M urea, 300 mM IgG4 Fc Protein Formulation imidazole, 0.1 rapigest (or Nonidet P-40 if to not0.5 M urea, 300 mM imidazole, 0.1 rapigest (or Nonidet P-40 if to…
. Enzyme histochemistry permitted to localize trypsin-like enzymes in T. absoluta L. Enzyme histochemistry permitted to localize trypsin-like enzymes in T. absoluta L3 larvae. The fluorescence signal was detected at…
Partial response; SD, steady disease; PD, progressive illness; PS, performance status.Partial response; SD, stable illness; PD, progressive disease; PS, efficiency status.Discussion CRC is actually a main public overall health concern,…
Itor12.two years and 80 had been female, 60 Caucasian, and 60 Scl-70 constructive. Duration ofItor12.two years and 80 were female, 60 Caucasian, and 60 Scl-70 optimistic. Duration of disease from…
Ofrontal cortex/mPFC (BA 11/10) Suitable FEF, orbitofrontal cortex/mPFC (BA 11/10) CognitiveOfrontal cortex/mPFC (BA 11/10) Proper FEF, orbitofrontal cortex/mPFC (BA 11/10) Cognitive handle network Left DLPFC, left superior frontal gyrus, medial…
Containing EDTA-2Na (15 mL/kg), followed by centrifugation at 1000 g atContaining EDTA-2Na (15 mL/kg), followed by centrifugation at 1000 g at four C for 15 min. The NAMPT Protein Biological…
NaCl, 100 mM sodium acetate (pH 5.5) containing 1 mg/ml pronase, and 1 mgNaCl, one hundred mM sodium acetate (pH five.five) containing 1 mg/ml pronase, and 1 mg/ml proteinase K…
YFIGURE 2. Gut function is improved in Tg mice given oral FTYYFIGURE two. Gut function is improved in Tg mice provided oral FTY720, whereas FTY720 has small impact on WT…
Ent NCDs/chronic illnesses.4. Frequent Outcomes of DIT and Risk ofEnt NCDs/chronic illnesses.four. Frequent Outcomes of DIT and Risk of Noncommunicable Illnesses (NCDs)One of the outcomes of your recent human research…
_F: GACTTCATGCCCACCA TCTT, MCM5_R: TCACGTGCAGAGTGATGACA; MCM6_F: AACCAGCAACTTTCCACCAC, MCM6_R_F: GACTTCATGCCCACCA TCTT, MCM5_R: TCACGTGCAGAGTGATGACA; MCM6_F: AACCAGCAACTTTCCACCAC, MCM6_R: GAAAAGTTCCGCTCACAAGC; MCM7_F: TGAGTTC GACAAGATGGCTG, MCM7_R: CCGTAGGTCAT TGTCTCGGT; expression modify was calculated working with the 2-Ct…
Tor experiments indicating the involvement of p38 but not JAK2 inTor experiments indicating the involvement of p38 but not JAK2 in HAS2 mRNA induction. Although the particular significance of Ser-727…
Angerhans cells are skin-resident immune cells that associate closely with keratinocytesAngerhans cells are skin-resident immune cells that associate closely with Keratinocytes within the epidermis by means of MIP-1 alpha/CCL3 Protein…
Lthough an undetectable viral level at week 4 or 12 is actually a excellentLthough an undetectable viral level at week four or 12 is often a superior predictor in the…
Lar obligate pathogenic bacteria with similar developmental cycle and cell biologyLar obligate pathogenic bacteria with equivalent developmental cycle and cell biology accountable for wide variety of ailments in unique hosts…
Oral gyrus is situated amongst the anterior and posterior lateral portionOral gyrus is positioned between the anterior and posterior lateral part of the fusiform. Hypoactivity of this area in ADHD…
Ly distinct (P0.05). There have been some probable explanations for these benefits.Ly distinct (P0.05). There had been some probable explanations for these outcomes. 1st, the lactone ring of SN-38 was…
Olitinib but not Tofacinitib DKK-3 Protein site decreased ALDH+ lung cancer cells indicating theOlitinib but not Tofacinitib decreased ALDH+ lung cancer cells indicating the part of JAK2 in this procedure…
Ve explored the link involving childhood Cadherin-11, Human (HEK293, His) trauma exposure, cancer remedy, dysregulationVe explored the hyperlink among childhood trauma exposure, cancer remedy, dysregulation of HPA axis and cortisol…
Toxins and citrinin are mycotoxins made by fungi developing on uniqueToxins and citrinin are mycotoxins produced by fungi expanding on diverse raw materials and agricultural commodities. Maximum levels of these…
N. Particularly, when categorized by MSKCC criteria,13 intermediate- and poor-risk patientsN. Especially, when categorized by MSKCC criteria,13 intermediate- and poor-risk patients demonstrated enhanced median survival compared with that predicted by…
S in TF and TFRC genes in between analyzed groups of individuals.S in TF and TFRC genes between analyzed groups of patients. The variations studied inside the miRNA serum profile,…
Revisiae prions. Very first, overexpression of Ctr4 as an YFP fusion resultedRevisiae prions. First, overexpression of Ctr4 as an YFP fusion resulted in Ctr4 clusters and ribbon-like patterns at the…
Ra certain for SAD1 (16) failed to detect cross-reacting protein in proteinRa distinct for SAD1 (16) failed to detect cross-reacting protein in protein preparations from the roots of these mutants…
Ence of three M UMP. The activity of your enzymes present inEnce of 3 M UMP. The activity with the enzymes present within the UMP-Glo assay was considerably inhibited by…
At roughly equal proportions beneath basal culture situations (31). Also toAt about equal proportions beneath basal culture circumstances (31). Furthermore to direct transcriptional regulation of HAS2, the impact of UTP…
G molecules in dM or uM, cells were permeabilized (Cytofix/CytopermG molecules in dM or uM, cells were permeabilized (Cytofix/Cytoperm kit; BD Biosciences) and incubated with Alexa Fluor 647-conjugated Akt (pS473)…
N. Nat Cell Biol. 2012;14(12):1282sirtuininhibitor4. 57. Kong LN, Zuo PP, Mu LN. Nat Cell Biol. 2012;14(12):1282sirtuininhibitor4. 57. Kong LN, Zuo PP, Mu L, Liu YY, Yang N. Gene expression profile…
H.S.; Fuchs, K.; Sullivan, L.; Comstock, C.H.; Sade, G.H.S.; Fuchs, K.; Sullivan, L.; Comstock, C.H.; Sade, G.R.; Eddleman, K.; et al. Part of second-trimester genetic sonography soon after Down syndrome…
Ofrontal cortex/mPFC (BA 11/10) Proper FEF, orbitofrontal cortex/mPFC (BA 11/10) CognitiveOfrontal cortex/mPFC (BA 11/10) Correct FEF, orbitofrontal cortex/mPFC (BA 11/10) Cognitive handle network Left DLPFC, left superior frontal gyrus, medial…
Articles had been 800 nm. Therefore, SN-38/NCs-A showed the most effective tumor accumulationArticles had been 800 nm. Thus, SN-38/NCs-A showed the best tumor accumulation among the 3 formulations.influence on dissolution,…
) was heated to 70 below Ar2 for 18 h. Just after cooling to space) was heated to 70 beneath Ar2 for 18 h. Just after cooling to area temperature,…
Cantly in B6.TNF-/- mice over the course of illnessCantly in B6.TNF-/- mice over the course of illness (Figure 3). higher levels of MCP-1 have been detected inside the B6.TNF-/- mice…
Ponse towards the GFD; (2) measuring the effect of reintroducing gluten followingPonse for the GFD; (2) measuring the effect of reintroducing gluten right after a period of therapy with all…
Ofrontal cortex/mPFC (BA 11/10) Right FEF, orbitofrontal cortex/mPFC (BA 11/10) CognitiveOfrontal cortex/mPFC (BA 11/10) Suitable FEF, orbitofrontal cortex/mPFC (BA 11/10) Cognitive control network Left DLPFC, left superior frontal gyrus, medial…
Neously with 1 106 BE (2)-c cells followed by instant therapy with 5000 mgNeously with 1 106 BE (2)-c cells followed by immediate treatment with 5000 mg/kg/day doses of OZ513…
Y was detected only in one particular pregnancy with pre-eclampsia and fetalY was detected only in one pregnancy with pre-eclampsia and fetal growth restriction; all other PG pregnancies showed regular…
At mimics the GTP-bound state in the protein (GTR1-Q65L) increases TORC1 activity during amino acid limitation, a situation that typically inactivates TORC1 . Although expression in the GTR1-Q65L allele brought…
Was observed in subpopulation of renal medullary cells which can be arrangedWas observed in subpopulation of renal medullary cells which might be arranged in rows (Figure three). COX2 immunofluorescence did…
Rectly and consequently stay prone to suffer from skinning injury more thanRectly and consequently stay prone to endure from skinning injury over a lengthy period just after harvest (Serra et…
Is positioned downstream of H2 O2 to mediate H2 O2 -induced sarcKATP channel stimulation in ventricular cardiomyocytes. Complementing evidence presented in the foregoing subsections that ROS/H2 O2 and ERK1/2 were…
Ere obtainable for the deceased kids. Genetic testing also identified the exact same mutation in the asymptomatic two-year-old daughter (III-3), who was promptly treated with oral nadolol (2 mg/kg). Holter…
E 1A) was adapted from previous work5,28. The chip was laser cut from acrylic sheets (McMaster Carr, Techplast). The chip best was 1/4” thick with three collinear holes five mm…
Fter treatment of LPS-stimulated macrophages with the drug I-BET (40), expression ofFter remedy of LPS-stimulated macrophages with the drug I-BET (40), expression in the TNF- gene following L. monocytogenes infection…
Al., 2013). However, muscle- or liver-specific deletion of SIRT3 GDF-11/BMP-11, Human (HEK293) didn’t resultAl., 2013). Nonetheless, muscle- or liver-specific deletion of SIRT3 didn’t result in adjustments in ATP levels, suggesting…
Altered, indicating the AITRL/TNFSF18 Trimer Protein Source presence of oxidative tension . This effect was observed at a late stage of infection and could have already been as a result…
Ctious Diseases, 2011, 204 Suppl three;S757?60. doi:10.1093/infdis/ jir296 pmid:21987747 35. Pan Y et al. Reston virus in domestic pigs in China. Archives of Virology, 2014, 159:1129?132. doi:10.1007/s00705-0121477-6 pmid:wpro.who.int/wpsarWPSAR Vol 6,…
Al cells . This finding suggests that ECyd causes Vaults dysfunction preferentiallyAl cells . This locating suggests that ECyd causes Vaults dysfunction preferentially in tumor cells, minimizing side effects in…
Ormin activates AMPK by inhibiting mitochondrial respiratory chain activity and increasingOrmin activates AMPK by inhibiting mitochondrial respiratory chain activity and rising 5-AMP in the expense of ATP . How AMPK…
Xpression didn’t exhibit a important effect on all round survival (data not shown). To validate the gene expression microarray data, we quantified EN1 mRNA levels inside a panel of breast…
Ncovered an inverse connection between the frequency of syntillas and amperometric ACTB Protein web events over time, similar to what we reported in our studies of spontaneous exocytosis. The getting…
Ors may perhaps TGF beta 2/TGFB2 Protein site present novel signifies for the remedy of cancer forms driven by PKC overexpression.therosclerosis, the key reason for morbidity and mortality in industrialized…
Ever making use of sugammadex in their everyday practice. Occasional use of sugammadexEver employing sugammadex in their daily practice. Occasional use of sugammadex was reported in 21 with the respondents.The…
Exes. The cathode buffer was 50 mM tricine, 15 mM Bis-Tris, pH 7.0, andExes. The cathode buffer was 50 mM tricine, 15 mM Bis-Tris, pH 7.0, and 0.02 Serva blue…
Is hydrogen bonded to water molecules by way of the ester and carboxy moieties, forming chains along the a-axis path. The methyl H atoms of the acetoxy group are disordered…
Ive instances with water and subjected to TFA hydrolysis (two M final concentration) for three h at 100uC. Just after that samples have been centrifuged plus the supernatants were collected.…
Maturity. Bar=50 m. (C) SEM picture of mature OsAP65+/+ pollen grains. Bar=50 m. (D) A larger magnification picture of a single pollen grain from (C). Bar=10 m. (E) TEM picture…
Of inner sequence positions, they call for changes of standard RNA synthesisOf internal sequence positions, they demand changes of regular RNA synthesis procedures which might represent a handicap for broader…
Y with the residue as a criterion and enhanced its performance. Having said that, so far no software, that we’re conscious of, makes use of the predicted effect of mutation…
Vs glargine (n = 159) plus metformin (each arms) FBG: 8.1 vs 6.5 mmol/L (P 0.001) PPBG: Breakfast 8.7 vs 9.two mmol/L (P = 0.03) Lunch eight.4 vs 9.8 mmol/L…
Ncubated with Alexa Fluor?488 fluorochrome-conjugated secondary antibody (Invitrogen, USA) in PBS, and had been then counterstained with 4,6-diamidino2-phenylindole (DAPI; Sigma-Aldrich, USA) in PBS. Nuclei have been examined making use of…
Es relies on seemingly telomerespecific molecular pathways. Nevertheless, it appears thatEs relies on seemingly telomerespecific molecular pathways. Nonetheless, it appears that similar pathways also play a role in DNA metabolism…
Ain promoter activities in the root-hair zone. A strong and veryAin promoter activities in the root-hair zone. A robust and very substantial (P , 0.001) increase in absorbance at 1735712…
Em for three min, which was confirmed to be adequate for equilibration. The data are reported as (one hundred ?T)/100, where T is transmittance ( ). Particle characterization The powerful…
Anosine pentaphosphate (pppGpp), accumulate beneath starvation circumstances (Chatterji and Ojha, 2001). On the one hand transcription of steady RNA species like tRNAs and rRNAs is repressed during Stringent Response, thereby…
Ovide additional information about the underlying causes of connected ailments, for example Hirschsprung’s and OIBD1,14,17. The purpose that ROS/redox fluorescent probes could so of IGF-I/IGF-1 Protein web course enhance the…
Copoeia, System II, a paddle strategy, was performed making use of a RCZ-Copoeia, Approach II, a paddle approach, was performed applying a RCZ-8A dissolution apparatus (Tianjin University Radio Factory, Tianjin,…
Exes. The cathode buffer was 50 mM tricine, 15 mM Bis-Tris, pH 7.0, andExes. The cathode buffer was 50 mM tricine, 15 mM Bis-Tris, pH 7.0, and 0.02 Serva blue…
Overexpressing cells. Fluorescence was excited employing the 488 nm line of the argon laser and recorded at a bandwidth of 500?50 nm. For GFP-1S and GFP-1C, images had been acquired…
Ing aspect for AF. A Danish cohort study supports the observation in the Japanese study; the Danish cohort study reported a monotonic, adverse, dose-response trend for DHA, EPA and DPA…
Ls. Discontinuations due to AEs numerically favoured NPH-insulin, but this resultLs. Discontinuations because of AEs numerically favoured NPH-insulin, but this outcome was not conclusive on account of modest numbers of…
Expression of its coding counterpart, AFAP1. Precise Inhibition of AFAP1-ASExpression of its coding counterpart, AFAP1. Certain Inhibition of AFAP1-AS1 Is Achieved With siRNAs, With no Effects on AFAP1 Expression To…
Unctate staining was also visible in type II alveolar epithelial cells (figure 3E, F).DISCUSSION To our understanding, this study is amongst the initial to examine the differential response of key…
Ied from an Iranian population had C-shaped canals. Inside a study of Rahimi et al. ; carried out in 2008 on the initial and second mandibular molars in an Iranian…
Ks post-infection. These benefits suggest a correlation among the lack of AQP4 and decreased generation of Th1 cells for the duration of S. japonicum infection.Treg cells are lowered in S.…
Copoeia, IFN-gamma Protein Species System II, a paddle strategy, was performed employing a RCZ-Copoeia, Technique II, a paddle process, was carried out employing a RCZ-8A dissolution apparatus (Tianjin University Radio…
Wnt4 Protein MedChemExpress Sponding band images from the MEFs. MWAs. The cells were lysedSponding band pictures in the MEFs. MWAs. The cells have been lysed at the time points indicated,…
Immature granulocytes using the absence of granulocytic dysplasia, monocytosis, eosinophilia, and basophilia . Further clinicopathologic qualities of CNL consist of splenomegaly, elevated Cathepsin S, Human (HEK293, His) vitamin B12 level,…
Bust analogue of mean, and IQR is actually a robust measure of variability; functionals which are robust to outliers are advantageous, provided the elevated prospective for outliers within this automatic…
ML) LDL-C5/HDL-C6 non-HDL-C/HDL-C 26.45 ?1.06 63.19 ?2.52 62.15 ?1.90 50.ten ?1.05 29.41 ?1.38 17.76 ?0.32 three.38 ?0.05 1.11 ?0.02 0.88 ?0.02 13180 ?1505 0.375 ?0.023 2.21 ?0.21 1.42 ?0.07 1.73…
The Ca2 source. We demonstrate that the time course for suchThe Ca2 supply. We demonstrate that the time course for such full maturation or superpriming of newcomer SVs is slower…
Channel modulators. J Biol Chem 275(47):36556?6561. 40. Durham WJ, et al. (2008) RyR1 S-nitrosylation underlies environmental heat stroke and sudden death in Y522S RyR1 knockin mice. Cell 133(1):53?5. 41. Pouvreau…
Hanges underlying 6OHDA-mediated dysfunction (Figure 6C). The present findings demonstrated that (1) 6-OHDA quickly mTORC1 Activator Accession blocked (30 min) mitochondrial trafficking in DA axons, a procedure accompanied by a…
He 900 mM TEA-Cl maintained the osmotic balance and chloride concentration across the bilayer though replacing gA-conductive K1 ions with non-conductive TEA30, generating a sizable distinction in concentration of conductive…
Nd 3 months following switching drugs. P 0.001, P = 0.006 in comparison with the baselineNd three months following switching drugs. P 0.001, P = 0.006 in comparison to the…
Ormin activates AMPK by inhibiting mitochondrial respiratory chain activity and escalatingOrmin activates AMPK by inhibiting mitochondrial respiratory chain activity and rising 5-AMP in the expense of ATP . How AMPK…
N Yua,b, Young Eun Hana,b, Young-Sun Jia,b, Keunhee Ohc, Jong-Woo Sohna, Ajin Lima, Jae-Pyo Jeonb, Hyunsu Leea,b, Kyu-Hee Leea,b, Suk-Ho Leea,b, Per-Olof Berggrend,e, Ju-Hong Jeonb,1, and Won-Kyung Hoa,b,a Cell Physiology…
group2 substitutions from the combined group1234 substitutions (hSTINGgroup134) strongly diminished DMXAA activation, whereas loss of any with the other groups was tolerated (Figure 1D, correct panel). These outcomes indicate that…
Localization (73). Interestingly, the deletion from the LI domain abolished IFNGR1 capping and redistributed IFNGR1 and actin into micropatches. Whether actin was essential for IFNGR1 endocytosis or BRD4 Modulator Gene…
Such because the beta cells on the pancreas) and non-self (this kind ofSuch as the beta cells of your pancreas) and non-self (such as bacteria and viruses). Inheriting selected HLA…
Ne hundred independent docking runs had been carried out for the disaccharide.Ne hundred independent docking runs had been carried out for the disaccharide. Outcomes were clustered in accordance with the…
Accordance with the suggestions within the Guide for the Care and Use of Laboratory Animals in the National Institutes of Well being. The animal protocols had been authorized by the…
E hydroxylation within the heart, possible inhibitors using a documented history of cardiotoxicity have been chosen. Danazol was incorporated since it is a certain inhibitor of CYP2J2 and causes congestive…
Nd/or decreased survival (Table 1) . New diagnostic methods are linking previously unidentified bacteria to colon cancer tumors, highlighting an emerging role for bacterially-driven host inflammation and colon cancer danger…
Of ICH had been unique involving the review groups. These benefits couldOf ICH were distinct in between the review groups. These benefits may very well be explained by the effect…
Rnatant was recentrifuged at 16,000 g for 15 min, and also the pellets have beenRnatant was recentrifuged at 16,000 g for 15 min, as well as the pellets were pooled,…
Actin, 1 l of cDNA template and the following specific primers had been made use of: PI-3K p85 forward 5′-GAA GGC AAC GAG AAG GA-3′, reverse 5′-CAC AAG TGT CAG…
Any phenotypic alteration within the adipose tissue of Agtrap??mice below HF loading, and Agtrap??mice certainly had substantially larger adipocytes inside the epididymal adipose tissue than WT Agtrap+/+ mice (diameter, 96.6?.2…
Ition of its metabolic end item calcium oxalate crystals in numerousItion of its metabolic end product calcium oxalate crystals in a variety of PI3KC3 custom synthesis organs.CASE PRESENTATIONA 58-year-old man…
Tic PME activity is itself post-translationally controlled by way of a 1 : 1 interaction withTic PME activity is itself post-translationally controlled via a 1 : 1 interaction with specific…
Munol 2011; 187: 2181?192. 23 Kline JN, Cowden JD, Hunninghake GW, Schutte BC, Watt JL, Wohlford-Lenane CL et al. Variable airway responsiveness to inhaled lipopolysaccharide. Am J Respir Crit Care…
At 10 kHz (Molecular Devices). Liquid junction potentials were calculated from the Clampex built-in JPCalcW plan and subtracted on the net. Cells have been RSK3 Inhibitor supplier viewed via DIC…
By environmental things, which includes siblings and care centers (15). The physical connection between the airways as well as the skin, oral cavity, and gastrointestinal tract have been proposed to…
Fter treatment method of LPS-stimulated macrophages with the drug I-BET (forty), expression ofFter therapy of LPS-stimulated macrophages using the drug I-BET (40), expression in the TNF- gene right after L.…
Salvage pathway and hydroxykynurenine within the de novo pathway, of NADSalvage pathway and hydroxykynurenine inside the de novo pathway, of NAD synthesis in ALK5 drug dcerk1 are enhanced compared with…
Pe?probe targeting BCAR4 was designed and synthesized by Advanced Cell Diagnostics and detection of BCAR4 expression was performed working with the RNAscope?2.0 Higher Definition (HD)–BROWN Assay according to the manufacturer’s…
Ectra have been visualized employing Sparky (Goddard TD, Kneller DG, SPARKY3, University of California, San Francisco). The onedimensional 1H NMR spectra had been plotted making use of the software program…
N (Supplementary Fig. S4A at JXB on the web). To confirm that the male defect was induced through the T-DNA interruption in OsAP65, the CDS of OsAP65 beneath the control…
N by proteolytic enzymes,9 these improve cancer cell’s capability forN by proteolytic enzymes,9 these boost cancer cell’s capability for migration and invasion. Decreased oxygen availability (hypoxia) in cancer cells is…
Approaches just usually do not have the capacity to home-in on small features on the information reflecting low probability components or collections of elements that collectively represent a uncommon biological…
Was consistent and much more than 60 . PK evaluation showed that TK900D and TK900E have moderate oral bioavailability of 30.eight and 25.9 , respectively. The apparent half-life ranged involving…
Cells may perhaps be FP Agonist review present in our cultures; nevertheless, further testing would be necessary to confirm the respiratory column cell identity. The Chx10 transcription element can also…
Ition of its metabolic finish product calcium oxalate crystals in variousItion of its metabolic end item calcium oxalate crystals in different organs.CASE PRESENTATIONA 58-year-old man with a history of hypertension,…
Ormin activates AMPK by inhibiting mitochondrial respiratory chain activity and increasingOrmin activates AMPK by inhibiting mitochondrial respiratory chain activity and rising 5-AMP in the expense of ATP . How AMPK…
Ase by six hours, which was then maintained for at least 24 hours.Ase by six hours, which was then maintained for no less than 24 hours. To ascertain whether radiation…
Hanism underlying insulin resistance, diabetes, and P2X7 Receptor Antagonist supplier Cardiovascular disease? The prevalent soil hypothesis revisited. Arterioscler Thromb Vasc Biol 24(five):816?23 Prentki M, Nolan CJ (2006) Islet beta cell…
Nt using the observations in Figure 2 mercury exposure of B10.S mice resulted in important increases in the IL-17 Antagonist Purity & Documentation expression of IFNc, TNF-a, IL-1b, and NRLP3…
Inactive, as analyzed by Northern blot hybridization (Figure 3C). The findingInactive, as analyzed by Northern blot hybridization (Figure 3C). The locating the exercise with the siRNA carrying a significant chemical…
In w1118, dcerk1, sirt2, and dcerk1.Caspase 6 medchemexpress dsirt2 fly mitochondria. The amountIn w1118, dcerk1, sirt2, and dcerk1.dsirt2 fly mitochondria. The level of ATP is calculated per milligram of mitochondrial…
Ll has sufficient time to sense the gravity vector, as a result, sensing no weight would have effects on cells equivalent to these of weightlessness. This system is named gravity-vector…
Dead from EBV may be embalmed (False) Right answers in parenthesis.Pre-workshop (n = 285) 80.0 ; 55.8 ; 34.0 ; 80.4 ; 96.eight ; Post-workshop (n = 364) 90.1 ;…
Grams of EPA+DHA every day are suggested below a physician’s care. Around 30 million folks at the moment take fish oil CD40 Inhibitor list supplements in the U.S. . Fish…
Interaction in between host cells and bacteria. Additionally, we demonstrate thatInteraction between host cells and bacteria. In addition, we demonstrate that N-glycosylation on the 68th asparagine residue on mouse CHI3L1…
Sponding band photos from the MEFs. MWAs. The cells were lysedSponding band images from the MEFs. MWAs. The cells have been lysed at the time points indicated, and MWAs were…
Hances airway fluid absorption. The net result is actually a reduction in airway surface liquid volume and impaired mucociliary clearance (Hobbs et al. 2013). The boost in ENaC activity identified…
Ration and clonogenic activity K-RAS mutation outcomes in constitutive K-RAS activity, as demonstrated by a pull-down assay using the GST-tagged Raf1-Ras-binding domain (Raf1-RBD) protein (Fig. 1A). Interestingly, despite the fact…
N common first-line regimen in PTCL; having said that, for probably the most frequentN standard first-line regimen in PTCL; on the other hand, for one of the most prevalent subtypes,…
Wafosis Co., Tokyo, Japan). The Drosophila heads have been examined by scanningWafosis Co., Tokyo, Japan). The Drosophila heads were examined by ErbB4/HER4 Formulation scanning electron microscopy (S-5000, Hitachi High-Technologies Co.,…
Topomer analysis. Right here, we present the initial broad mGluR5 drug analysis of ECM protein kinetics during the onset of experimental pulmonary fibrosis. Mice were labeled with heavy water for…
Rface with the TT. The nominal CRU model includes a square 7 ?7 array of RyRs and seven LCCs distributed evenly over the RyR IL-4 Inhibitor drug cluster (Fig. 1…
T 67 dpi by a recovery phenotype associated having a high quantity of repressed transcripts, therefore creating an unfavourable cellular environment to support SACMV infection. Even though cassava Sigma 1…
And shRNA-expressing (Turbo-GFP ) cells had been sorted by a fluorescence-activated cell sorterAnd shRNA-expressing (Turbo-GFP ) cells had been sorted by a fluorescence-activated cell sorter (FACS) right after five days…
In w1118, dcerk1, sirt2, and dcerk1.dsirt2 fly mitochondria. The amountIn w1118, dcerk1, sirt2, and dcerk1.dsirt2 fly mitochondria. The quantity of ATP is calculated per Akt3 MedChemExpress milligram of mitochondrial protein…
Em for three min, which was proven to be enough for equilibration. The information are reported as (one hundred ?T)/100, where T is transmittance ( ). Particle characterization The efficient…
Sed by both HEV and CAP. Aquaporins 1, 7 and 11, which regulate tissue fluid, glycerol and potentially CO2 exchange12, had been expressed exclusively (Aqp7 and 11) or additional extremely…
D pre-column. The wavelength was set at 230 nm with a flowD pre-column. The wavelength was set at 230 nm having a flow rate of 1 mL in-1 along with…
With a T-DNA organisational structure conducive to effective integration of clonedHaving a T-DNA organisational structure conducive to HDAC6 Compound efficient integration of cloned DNA into the plant genome. Plant Molecular…
Tion. The mTOR pathway was over-activated in lal-/- ECs, and inhibition of mTOR in lal-/- ECs partially reversed their dysfunctions, which includes decreasing transMps1 medchemexpress migration of MDSCs, EC migration,…
Btained with TNP-ATP as an antagonist. A317491 has no structural similarity to any on the P2X agonists, but is often a particular antagonist for the P2X3R (also as for P2X2/3;…
U et al.US FDA companion diagnostics co-development requirementan investigator-initiated trial (28) or previously undetected ALK rearrangement (41). Advances in the understanding of neoplastic illnesses couple with technical advancement within the…
E and choose cargo. (v) PKCθ manufacturer autophagy receptors including p62 regulateE and select cargo. (v) Autophagy receptors for instance p62 regulate the selective autophagosomal degradation of significant protein aggregates,…
Rnatant was recentrifuged at 16,000 g for 15 min, along with the pellets wereRnatant was recentrifuged at 16,000 g for 15 min, plus the pellets were pooled, washed, and HDAC10…
Ready from 8:two L:S could remain in dissolution medium but theReady from 8:two L:S could remain in dissolution medium however the water sorption was lesser than that of the five:five…
Ivided into blank control group, model (H. pylori) group in which cells have been treated for 60 min, and RC-derived diterpenoid C (20 g/mL) + H. pylori group in which…
Te-sex pheromonal odors: 6-OHDA lesions of DA terminals in this area abolished the hardwired preference of female mice for breeding male over estrous female urinary odors (volatiles and volatiles+nonvolatiles), while…
S described over was applied. RNA Interference and Northern Analysis. DeliveryS described above was utilized. RNA Interference and Northern Analysis. Delivery of siRNAs into cells and evaluation of gene silencing…
Al handle in excess of drug release. Photodegradable groups are used in the presence of live cells to uncage neurotransmitters5, to pattern physical voids inside a hydrogel6?, and also to…
E to examine substantial parameter spaces to figure out how mGluR7 medchemexpress unique signalingE to examine substantial parameter spaces to ascertain how distinctive signaling pathways may cooperatively influence MSC growth…
Mbrane association correlates using the assembly status and subunit composition ofMbrane association correlates with the assembly status and subunit composition from the complex (Kotchoni et al., 2009), and may very…
Ells/well) cultured for 24 h have been co-cultured with B16-F10 or iB16-shGCR cells (5.06105cells/well; pre-cultured for 24 h). Twenty minutes immediately after the addition of tumor cells to the HSE,…
Isms are required to define potential treatments (e.g. by means of diet programIsms are essential to define possible treatment options (e.g. via diet program). The association amongst fillet firmness plus…
Decline is accounted for Caspase medchemexpress largely by a rise in state 4 respirationDecline is accounted for largely by an increase in state four respiration even though state 3 respiration…
Identified as pan-cancer mechanisms of response (PI Score .1.0; Step five). A subset in the pan-cancer markers correlated with drug response in person cancer lineages are selected as lineage-specific markers.…
Erent concentrations (four, eight, 16 and 20 mg/ml). Following the emulsion was added into every test tube, the absorbance at zero time was measured right away at 470 nm utilizing…
Detected a great deal larger amounts of Pb (two,20014,200 ng/g DW) in red and brown seaweeds (39). The Cd level in P. haitanensis (3,408 ng/g DW) was somewhat greater than…
Ced having a new media without GNODE, and cells had been returnedCed having a new media devoid of GNODE, and cells have been returned to 37 incubator for 0, two,…
Eral biochemical markers.The-RDS.orgRev Diabet Stud (2013) 10:58-The Assessment of DIABETICEral biochemical markers.The-RDS.orgRev Diabet Stud (2013) ten:58-The Critique of DIABETIC Studies Vol. 10 No. 1Hegazy et al.Table 1. Nucleotide sequence for…
Amino acid deletion related with CdLS . The level of rRNA inAmino acid deletion related with CdLS . The level of rRNA inside the smc1Q843D strain was also rescued by…
Inactive, as analyzed by Northern blot hybridization (Figure 3C). The gettingInactive, as analyzed by Northern blot hybridization (Figure 3C). The acquiring the activity from the siRNA carrying a considerable chemical…
Or comparison, the levels of PEA measured two h immediately after single administration of URB597 increased in the hippocampus (t = three.436, df = ten, p \ 0.01), dorsal striatum…
Insulin lispro and insulin aspart.23 Other in vitro studies have also shown that insulin aspart has the lowest threat of isoelectric precipitation and, accordingly, less tendency to catheter occlusion compared…
Tracer by injection or gavage is much more complicated than simple incubation with ROS probes. General, this staining assay was shown to become a helpful newnature/ERβ Agonist Synonyms scientificreportsFigure 5…
Fter treatment method of LPS-stimulated macrophages with the drug I-BET (forty), expression ofFter treatment of LPS-stimulated macrophages with all the drug I-BET (40), expression on the TNF- gene immediately after…
Thanol. For Western blotting, mouse anti-DDK antibody (OriGene) was made use of atThanol. For Western blotting, mouse anti-DDK antibody (OriGene) was made use of at 1:two,000, mouse anti-ATP synthase was…
Fore, the probability that the NPY Y5 receptor Formulation nasopharyngeal carcinoma within this patient was a synchronous second principal cancer was extremely low. In addition, nasopha r yngeal SCC is…
Rome, this will incredibly probably influence clinical practice and inform investigators concerning the pathogenesis of this disease manifestation.In summary, there have already been a number of recent fascinating developments within…
He manufacturer’s directions (R D Systems, Minneapolis, Minnesota). Therapy with cathepsin-B inhibitor CA-074. CA-074 (L-3-trans(Propylcarbamoyl)oxirane-2-carbonyl)-L-isoleucyl-L-proline) (MW 383.44) (Peptide Institute Inc, Japan or EMD4Biosciences, Gibbstown, New Jersey) was employed as a…
Chemotherapy at an earlier time point. Future prospective research are warrantedChemotherapy at an earlier time point. Future potential research are warranted to confirm the usefulness of monitoring NLR in treating…
Ncorporation, normalized to empty vector or nontargeted shRNA management lines. PNcorporation, normalized to empty vector or nontargeted shRNA handle lines. P 0.01 (ANOVA); P 0.05 (1-sample t check and 2-tailed…
Ion of aggrecan and collagen II, though increasing production of collagen I . Despite the elongated cell morphologies observed in the +MP+TGF- MSC spheroids, no phenotypic evidence was observed determined…
Mg/ml) for 3 h at 37 1C. After derivation, iPSCs had been initially grown on a MEF feeder layer in human embryonic stem cell (ES) medium, that is, knockout DMEM…
Ividual shown in Fig. 3).British Journal of NutritionDiscussionOur interest in dietary lactose as an immunomodulatory molecule results from studies showing that the Tim-3/Gal-9 pathway is critical for regulating T-cell responses…
E basic amino acid permease Gap1, on which TORC1-dependent, RspE general amino acid permease Gap1, on which TORC1-dependent, Rsp5-mediated ubiquitilation has been described previously (57), as well as the Rsp5…
Sis.Evidence-Based Complementary and Option Medicine utilised as inhibitors. The finalSis.Evidence-Based Complementary and Alternative Medicine utilised as inhibitors. The final concentration with the constituent of Coptis chinensis as a substrate was…
Nd: C, 70.89; H, 5.26; N, five.57.NoteASSOCIATED CONTENTS Supporting InformationNMR spectra and crystallographic information. This material is offered cost-free of charge through the web at pubs.acs.org.AUTHOR INFORMATIONCorresponding Author NotesE-mail: [email protected].…
Creased age . Similarly, within the present study, the youngest age groups had the highest intensity of infection. Our study further showed that inside the study location, infection with S.…
S having Langerhans cell histiocytosis and acquired chemotherapy . Salmonella infection wasS acquiring Langerhans cell histiocytosis and obtained chemotherapy . Salmonella infection was reported in only 5 of scenarios .…
Operties of this molecule, brief half-life, and poor MEK1 site bioavailability make itOperties of this molecule, brief half-life, and poor bioavailability make it a perfect candidate for transdermal delivery utilizing…
Centration-response curves for ET-1 showed enhanced strain generation in the course of isometric vascular smooth muscle contraction in LAD from IT C60 instilled male rats compared with vehicle. (B) Cumulative…
Er (Fig. 9A). IK-1 also failed in reporter assays to inhibit R-mediated activation of the EBV SM and BHLF1 promoters in EBV HONE cells (information not shown), and it even…
E created for each and every gene for amplification of promoter and IP Antagonist list transcribed regions (Supplemental Figure 4 and Supplemental Table 6).Molecular PlantGenome-Wide Epigenetic Silencing by VIM ProteinsFigure…
He second generation. Conclusions: Thinking of the direct and maternal effects ofHe second generation. Conclusions: Thinking about the direct and maternal effects of dietary PUFAs on host and parasite we…
H di-tert-butyldiaziridinone (1) and Pd(PPh3)4 led to a novel ErbB2/HER2 Formulation sequential allylicH di-tert-butyldiaziridinone (1) and Pd(PPh3)four led to a novel sequential allylic and aromatic C-H amination approach, providing a…
Amide in ameliorating attacks of weakness in HypoPP and hyperkalaemic periodic paralysis will not be identified,Bumetanide within a CaV1.1-R528H mouse model of hypokalaemic periodic paralysis though proposals have incorporated activation…
Depth analyses of sulfatases of unknown function that had been identified in a genome-wide look for sulfatases in humans. In fact, for quite a few sulfated substrates, the corresponding sulfatases…
And these proteins synergistically amplified LPS-inducible Edn1 CD40 Inhibitor custom synthesis promoter activity (Fig. 8A). Lastly, Hdac7-u promoted the production of IL-6, IL-12p40, and, to a lesser extent, TNF- (Figs.…
Systemic LPS-induced inflammation, JQ1 increases the susceptibility to DSS-induced colitis.DISCUSSIONTheSystemic LPS-induced inflammation, JQ1 increases the susceptibility to DSS-induced colitis.DISCUSSIONThe key aim of our study was to elucidate steps involved in…
In relation to NST complexes have been obtained based on the MDIn relation to NST complexes had been obtained determined by the MD simulations. The RMSD of aGlcN-(1R4)-GlcA atoms rose…
Ar profile. However, broad adoption of this method has been hindered by an incomplete understanding for the determinants that drive tumour response to distinct cancer drugs. Intrinsic variations in drug…
E patterns were supported by image analyses applying GIS and Daime programs and resulted in statistically (p 0.001) higher abundances of SRM inside the surfaces of Type-2 mats (when compared…
Ranial hypertension. Outcomes are provided as medians (IQR).Abbreviations CT: computedRanial hypertension. Results are given as medians (IQR).Abbreviations CT: computed tomography; GCS: Glasgow Coma Scale; HES: hydroxyethyl starch; HSS: hypertonic saline…
Ordingly, fiber bridges have been explicitly placed on this plane using aOrdingly, fiber bridges have been explicitly placed on this plane using a uniform spacing, and modeled using the constitutive…
O respond to TAM. Chrisholm et al. also showed cytotoxic effects of EGCG alone in another ER-negative breast cancer cell line, Hs578T in addition to a synergistic cytotoxic impact of…
By contaminated mice was examined employing an experimental strategy described byBy contaminated mice was tested making use of an experimental strategy described by Serbina et al. (50). Splenocytes isolated just…
Salvage pathway and hydroxykynurenine inside the de novo pathway, of NADSalvage pathway and hydroxykynurenine inside the de novo pathway, of NAD synthesis in dcerk1 are elevated compared with these in…
D the consequence of preincubation together with the fibril modulators, fluorescence anisotropy of PC/PG (1:1) LUVs that incorporate the fluorescence dye TMA-DPH was measured. The fluorescence anisotropy of TMA-DPH fluorophore,…
Nsgene expression, the severity from the condition in PD-1 Tg miceNsgene expression, the severity of the disorder in PD-1 Tg mice was drastically lowered. About the contrary, PD-1 deficiency accelerated…
Eral biochemical markers.The-RDS.orgRev Diabet Stud (2013) ten:58-The Review of DIABETICEral biochemical markers.The-RDS.orgRev Diabet Stud (2013) 10:58-The Review of DIABETIC Research Vol. ten No. 1Hegazy et al.Table 1. Nucleotide sequence for…
Ocols. Proteins have been separated on 4-15 gradient sodium dodecyl sulfate (SDS)-polyacrylamide gels and transferred to Immobilon-P membranes (Millipore, Billerica, MA). The following primary antibodies had been applied: Akt, PARP,…
Entation points towards the importance of sustaining the health with the axonal compartment. Whilst it remains to become observed whether or not other PD toxin models, which include paraquat or…
By the strategy of Bradford,40 Estrogen receptor drug utilizing bovine serum albumin (BSA) asBy the approach of Bradford,40 making use of bovine serum albumin (BSA) as the normal. 4.4. Reductions…
Nduces AMPK activation in pancreatic -cells, which results in an increase in KATP channel trafficking to the plasma membrane.Signaling Mechanism for AMPK Activation by Leptin in Pancreatic -Cells. Involvement of…
Tility . They cause membrane rupture by stimulatingPLOS A single | plosone.orgthe ECM remodelling PPARβ/δ Activator Molecular Weight enzyme MMP-9, that in turn results in cell apoptosis and breakdown of…
Dothelial cell monolayer integrity and barrier properties by means of paracrine signaling mechanismsDothelial cell monolayer integrity and barrier properties via paracrine signaling mechanisms, with full-length oxygenated PAPC merchandise showing barrier…
On might be an essential aspect within this metabolic reprogramming (KimOn may very well be a vital aspect in this metabolic reprogramming (Kim et al., 2010; Finley et al., 2011a).…
Hat these effects happen as a consequence of various, metformin-induced adjustments in signaling each upstream and downstream with the insulin and IGF1 receptors. As well as fast, systemic adjustments in…
Erefore, mixture therapy with milrinone and low-dose landiolol may possibly be aErefore, combination therapy with milrinone and low-dose landiolol could possibly be a superior therapeutic strategy for ADHF because it…
Pure water at reflux for 24 h effected clean hydrolysis of yourPure water at reflux for 24 h effected clean hydrolysis of your auxiliary. Simple acidbase extraction then provided acid…
E experiments is located in Supporting Data. In experiments on NO/nitrite release from BChE manufacturer bladders, basal release and release for the duration of infusion of acetylcholine 100 mM in…
Cavity (Figure 4A) (P 0.01) and an attenuation in level of cartilage destruction within the IFN- intervention group (Figure 4B) (P 0.05). qRT-PCR was TrkC Activator Compound performed to decide…
Ssion construct we observed that PTEN is often a direct target ofSsion construct we observed that PTEN is really a direct target of miR-21 in MDM (Fig 4A ). Overexpression…