Product Name :
Griffonilide

Synonym :

Chemical Name :

CAS NO.:
61371-55-9

Molecular formula :

Molecular Weight:

Classification :
MedChemExpress Products > Research Chemicals > Griffonilide

Description:
Griffonilide is a plant-derived natural product that has been shown to have cytotoxic, anti-inflammatory, and immunosuppressive properties. Griffonilide is a mixture of compounds that are extracted from the culture supernatant of a fungus called Griffonia simplicifolia. It has been shown to have cytotoxic effects on cancer cells and hyperproliferative diseases such as psoriasis. Griffonilide also inhibits the growth of bacteria by binding to fatty acids in their cell membranes. The anti-bacterial activity of griffonilide is not affected by fatty acids or by eluting with water, but is inhibited by elution with protocatechuic acid.

Purity :
>98%

Specifications :
5 mg

Price.:
85

Price unit :
$

Inventory :
In stock

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.
Related websites: https://www.medchemexpress.com
862507-23-1 custom synthesis 98-92-0 site PMID:20301472 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Recombinant Salmonella enterica I Flagellin(fljB)

Brief Description :
Recombinant Protein

Accession No. :
E7CIA8

Calculated MW :
52.3 kDa

Target Sequence :
MAQVINTNSLSLLTQNNLNKSQSALGTAIERLSSGLRINSAKDDAAGQAIANRFTANIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQRLNEIDRVSGQTQFNGVKVLAQDNTLTIQVGANDGETIDIDLKQINSQTLGLDSLNVQKAYDVSATDVISSTYSDGTQALTAPTATEIKAALGNPTVTGDTLTATVSFKDGKYYATVGGYTDAGDTAKNGKYEVTVDSATGAVSFGATPTKSTVTGDTAVTKVQVNAPVPVAADAATKKALQDGGVSSADASAATLVKMSYTDKNGKTIEGGYALKAGDKYYAADYDEATGAIKAKTTSYTAADGTTKTAANQLGGVDGKTEVVTIDGKTYNASKAAGHDFKAQPELAEAAAKTTENPLQKIDAALAQVDALRSDLGAVQNRFNSAITNLGNTVNNLSEARSRIEDSDYATEVSNMSRAQILQQAGTSVLAQANQVPQNVLSLLR

Storage :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Application Details :

Uniprot :
E7CIA8

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Ofloxacin In Vitro EphB6 Antibody In stock PMID:34690413 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Recombinant Rat Vitamin K-dependent protein C(Proc)

Brief Description :
Recombinant Protein

Accession No. :
P31394

Calculated MW :
49.3 kDa

Target Sequence :
ANSFLEEVRAGSLERECMEEICDFEEAQEIFQNVEDTLAFWIKYFDGDQCSTPPLDHQCDSPCCGHGTCIDGLGGFSCSCDKGWEGRFCQQEMGFQDCRVKNGGCYHYCLEETRGRRCRCAPGYELADDHMHCRPTVNFPCGKLWKRTDKKRKNFKRDIDPEDEELELGPRIVNGTLTKQGDSPWQAILLDSKKKLACGGVLIHTSWVLTAAHCLESSKKLTVRLGEYDLRRRDPWELDLDIKEVLVHPNYTRSNSDNDIALLRLSQPATLSKTIVPICLPNSGLAQELSQAGQETVVTGWGYQSDKVKDGRRNRTFILTFIRIPLAARNDCMQVMNNVVSENMLCAGIIGDTRDACDGDSGGPMVVFFRGTWFLVGLVSWGEGCGHLNNYGVYTKVGSYLKWIHSYIGERDVSLKSPKL

Storage :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Application Details :

Uniprot :
P31394

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Prednisolone disodium medchemexpress ALDH1A1 Antibody custom synthesis PMID:34964248 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Recombinant Zaire ebolavirus Nucleoprotein(NP),partial

Brief Description :
Recombinant Protein

Accession No. :
P18272

Calculated MW :
45.1 kDa

Target Sequence :
LDEDDEDTKPVPNRSTKGGQQKNSQKGQHIEGRQTQSRPIQNVPGPHRTIHHASAPLTDNDRRNEPSGSTSPRMLTPINEEADPLDDADDETSSLPPLESDDEEQDRDGTSNRTPTVAPPAPVYRDHSEKKELPQDEQQDQDHTQEARNQDSDNTQSEHSFEEMYRHILRSQGPFDAVLYYHMMKDEPVVFSTSDGKEYTYPDSLEEEYPPWLTEKEAMNEENRFVTLDGQQFYWPVMNHKNKFMAILQHHQ

Storage :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Application Details :

Uniprot :
P18272

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Humanm Placental lactogen Antibody manufacturer Prazosin Adrenergic Receptor PMID:34783208 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Recombinant Mycobacterium tuberculosis Adenylate kinase(adk)

Brief Description :
Recombinant Protein

Accession No. :
A5U0B9

Calculated MW :
36.1 kDa

Target Sequence :
MRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGTKLGVEAKRYLDAGDLVPSDLTNELVDDRLNNPDAANGFILDGYPRSVEQAKALHEMLERRGTDIDAVLEFRVSEEVLLERLKGRGRADDTDDVILNRMKVYRDETAPLLEYYRDQLKTVDAVGTMDEVFARALRALGK

Storage :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Application Details :

Uniprot :
A5U0B9

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
TSG101 Antibody manufacturer HO-1 Protein, Human Epigenetics PMID:34871120 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Recombinant Human Immunoglobulin J chain(JCHAIN)

Brief Description :
Recombinant Protein

Accession No. :
P01591

Calculated MW :
20.6 kDa

Target Sequence :
QEDERIVLVDNKCKCARITSRIIRSSEDPNEDIVERNIRIIVPLNNRENISDPTSPLRTRFVYHLSDLCKKCDPTEVELDNQIVTATQSNICDEDSATETCYTYDRNKCYTAVVPLVYGGETKMVETALTPDACYPD

Storage :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Application Details :

Uniprot :
P01591

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
TGF β Receptor II Antibody In Vitro CD370 Antibody Epigenetics PMID:33909982 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Recombinant Outer-membrane lipoprotein carrier protein

Brief Description :
Recombinant Protein

Accession No. :
A7ZYJ5

Calculated MW :
22.3 kDa

Target Sequence :
DAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINVGRDGTIHQFSAVEQDDQRSSYQLKSQQNGAVDAAKFTFTPPQGVTVDDQRK

Storage :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Application Details :

Uniprot :
A7ZYJ5

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
OTUD4 Antibody Autophagy FCER1A Antibody Purity PMID:35055249 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Phosphoglucomutase-1

Brief Description :
Recombinant Protein

Accession No. :
Uniprot ID:P36871

Calculated MW :

Target Sequence :

Storage :
Store at -20˚C. (Avoid repeated freezing and thawing.)

Application Details :
Storage Buffer:50mM NaH2PO4, 500mM NaCl Buffer with 500mM Imidazole,10%glycerol(PH8.0)gene_full_name:PGM1

Uniprot :
P36871

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
HSC70 Antibody Purity & Documentation CD244 Antibody Epigenetic Reader Domain PMID:35180159 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Vasopressin-neurophysin 2-copeptin

Brief Description :
Recombinant Protein

Accession No. :
Uniprot ID:P01186

Calculated MW :

Target Sequence :

Storage :
Store at -20˚C. (Avoid repeated freezing and thawing.)

Application Details :
Storage Buffer:50mM NaH2PO4, 500mM NaCl Buffer with 500mM Imidazole,10%glycerol(PH8.0)gene_full_name:Avp

Uniprot :
P01186

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
PDHA1 Antibody Protocol FCER1A Antibody Autophagy PMID:35084960 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Coagulation factor XII

Brief Description :
Recombinant Protein

Accession No. :
Uniprot ID:P98140

Calculated MW :

Target Sequence :

Storage :
Store at -20˚C. (Avoid repeated freezing and thawing.)

Application Details :
Storage Buffer:50mM NaH2PO4, 500mM NaCl Buffer with 500mM Imidazole,10%glycerol(PH8.0)gene_full_name:F12

Uniprot :
P98140

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Avexitide Description Inotuzumab Epigenetic Reader Domain PMID:35057008 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com