Product Name :
Starch from potato

Synonym :

Chemical Name :

CAS NO.:
9005-25-8

Molecular formula :

Molecular Weight:

Classification :
MedChemExpress Products > Carbohydrates > Polysaccharides > Polysaccharides from Higher Plants > Starch from potato

Description:
Starch is an energy storing polysaccharide produced by higher plants and some algae. Pure starch is a white, tasteless and odorless powder that is insoluble in cold water or alcohol. It consists of two types of polysaccharide: the linear and helical amylose (α-1,4-linked glucose) and the branched amylopectin (α-1,4 and α-1,6-linked glucose). Depending on the plant, starch generally contains 20 to 25% amylose and 75 to 80% amylopectin by weight.

Purity :
>98%

Specifications :
100 g

Price.:
30

Price unit :
$

Inventory :
In stock

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.
Related websites: https://www.medchemexpress.com
1374248-81-3 Description 59-92-7 supplier PMID:28613558 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Tachykinin-3

Brief Description :
Recombinant Protein

Accession No. :
Q9UHF0Gene name:TAC3

Calculated MW :

Target Sequence :

Storage :
Store at -20C. (Avoid repeated freezing and thawing.)Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Application Details :

Uniprot :
Q9UHF0

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
TNFRSF11B Antibody Purity & Documentation Phospho-DRP1(Ser616) Antibody Autophagy PMID:35069823 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Dencichine

Synonym :

Chemical Name :

CAS NO.:
5302-45-4

Molecular formula :
C5H8N2O5

Molecular Weight:
176.13 g/mol

Classification :
MedChemExpress Products > Research Chemicals > Dencichine

Description:
Dencichine is an anti-inflammatory and anti-ulcer agent that has been shown to prevent oxidative injury in the bowel. The mechanism of this drug is not yet known, but it may be due to its antioxidant properties. Dencichine also has a protective effect on the epithelial cells and prevents the loss of cell-to-cell contact. This drug also has been shown to have a protective effect against bowel disease in mice. Dencichine is absorbed by the intestine, with high water permeability, and accumulates in the bowel. It inhibits intestinal inflammation by inhibiting prostaglandin synthesis, which may be due to its inhibition of cyclooxygenase or lipoxygenase activity.

Purity :
>98%

Specifications :
10 mM * 1 mL

Price.:
182

Price unit :
$

Inventory :
In stock

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.
Related websites: https://www.medchemexpress.com
53-86-1 Formula 849214-04-6 manufacturer PMID:30321012 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Coagulation factor XI

Brief Description :
Recombinant Protein

Accession No. :
P03951Gene name:F11

Calculated MW :
26.18

Target Sequence :

Storage :
Store at -20C. (Avoid repeated freezing and thawing.)Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Application Details :

Uniprot :
P03951

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Cy5-DBCO Epigenetics CD38 Antibody Purity PMID:34968408 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
1,2-O-Isopropylidene-a-D-xylofuranose

Synonym :
1,2-O-(1-Methylethylidene)-a-D-xylofuranoseMAX

Chemical Name :

CAS NO.:
20031-21-4

Molecular formula :
C8H14O5

Molecular Weight:
190.19 g/mol

Classification :
MedChemExpress Products > Carbohydrates > Monosaccharides > 1,2-O-Isopropylidene-a-D-xylofuranose

Description:
Chiral building block for synthesis of carbohydrate and nucleoside derivatives

Purity :
>98%

Specifications :
5 g

Price.:
30

Price unit :
$

Inventory :
In stock

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.
Related websites: https://www.medchemexpress.com
2627-69-2 IUPAC Name 9001-73-4 site PMID:30285350 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Beta-defensin 1

Brief Description :
Recombinant Protein

Accession No. :
P60022Gene name:DEFB1

Calculated MW :
3.96

Target Sequence :

Storage :
Store at -20C. (Avoid repeated freezing and thawing.)Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Application Details :

Uniprot :
P60022

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
KIF6 Antibody Technical Information RAD50 Antibody MedChemExpress PMID:35034519 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Decachlorobiphenyl

Synonym :

Chemical Name :

CAS NO.:
2051-24-3

Molecular formula :
C12Cl10

Molecular Weight:
498.66 g/mol

Classification :
MedChemExpress Products > Controlled Products > Decachlorobiphenyl

Description:
Decachlorobiphenyl is a chemical that is produced by the reaction of chlorine with biphenyl or diphenyl ether. Decachlorobiphenyl has been shown to inhibit the enzyme activity of fatty acid synthase in liver cells, which is responsible for synthesizing fatty acids. It also inhibits the enzyme activity of acetyl-CoA carboxylase, which is involved in regulating the production of ketone bodies and fatty acids. The mechanism of action for decachlorobiphenyl inhibition of these enzymes is thought to be due to its ability to bind to the active site and interfere with the formation of an enzyme-substrate complex. Decachlorobiphenyl can be detected using chemical ionization mass spectrometry at m/z=313 and 314, corresponding to C13H9Cl10+ and C13H9Cl7+, respectively.

Purity :
>98%

Specifications :
20 mg

Price.:
160

Price unit :
$

Inventory :
Out of stock

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.
Related websites: https://www.medchemexpress.com
58001-44-8 InChIKey 2250025-88-6 Description PMID:30137778 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Recombinant Human Fibroblast Growth Factor 2,FGF-2,FGFb (Gly132-Ser288)

Brief Description :

Accession No. :
P09038

Calculated MW :
16.4kDa

Target Sequence :
GTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Storage :
Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7C for 2-7 days.Aliquots of reconstituted samples are stable at < -20C for 3 months.

Application Details :

Uniprot :
P09038

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Sapanisertib In stock Bag3 Antibody site PMID:34688536 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Eupalinilide-D

Synonym :

Chemical Name :

CAS NO.:
757202-14-5

Molecular formula :
C15H19ClO5

Molecular Weight:
314.76 g/mol

Classification :
MedChemExpress Products > Life Sciences > Eupalinilide-D

Description:
Eupalinilide-D is a peptide inhibitor of voltage-gated sodium channels. It is a potent, selective, and cell-permeable blocker of the high-threshold A type (I A ) and intermediate-threshold C type (I C ) sodium channels in rat dorsal root ganglion neurons. Eupalinilide-D can also inhibit the activation of voltage-gated potassium channels by blocking the binding site for GABA on the channel. Eupalinilide-D has been used as a research tool to study the effects of peptides on ion channel function in cells and animal models.

Purity :
>98%

Specifications :
null

Price.:
null

Price unit :
$

Inventory :

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.
Related websites: https://www.medchemexpress.com
52-67-5 MedChemExpress 9004-32-4 SMILES PMID:29494119 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Recombinant Human T-lymphocyte activation antigen CD80(CD80)

Brief Description :
Recombinant Protein

Accession No. :
P33681

Calculated MW :
32.8 kDa

Target Sequence :
VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNLLPSWAITLISVNGIFVICCLTYCFAPRCRERRRNERLRRESVRPV

Storage :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Application Details :

Uniprot :
P33681

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Masofaniten MedChemExpress PDE1B Antibody medchemexpress PMID:35223193 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com