Product Name :
MNI-caged-L-glutamate

Synonym :
Caged glutamate

Chemical Name :

CAS NO.:
295325-62-1

Molecular formula :
C14H17N3O6

Molecular Weight:
336.8 g/mol

Classification :
MedChemExpress Products > Life Sciences > Ligands > Metabotropic Glutamate Receptors > MNI-caged-L-glutamate

Description:
A light-sensitive probe that functionally encapsulates L-glutamate in an inactive form. Irradiation with light at 360-380 nm cleaves the MNI protecting group and allows the release of free L-glutamate. It allows tuneable control of the L-glutamate in neurons and precise control over time, dose and location of L-glutamate release.

Purity :
>98%

Specifications :
null

Price.:
null

Price unit :
$

Inventory :

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.
Related websites: https://www.medchemexpress.com
9004-32-4 InChIKey 81-24-3 SMILES PMID:28516515 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Recombinant Human ZWINT

Brief Description :
Recombinant Protein

Accession No. :
Swissprot:O95229Gene Accession:BC020979

Calculated MW :

Target Sequence :

Storage :
-20~-80˚C, pH 7.6 PBS

Application Details :

Uniprot :
O95229

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Opicinumab Data Sheet CDKN1C Antibody Cancer PMID:34808293 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Hybridaphniphylline B

Synonym :

Chemical Name :

CAS NO.:
1467083-09-5

Molecular formula :
C37H47NO11

Molecular Weight:
681.8 g/mol

Classification :
MedChemExpress Products > Natural Products > Hybridaphniphylline B

Description:
Hybridaphniphylline B is a quinolone alkaloid that is found in the roots of Daphniphyllum macropodum. This compound has been shown to inhibit the growth of bacteria by inhibiting protein synthesis through a diels–alder reaction. Hybridaphniphylline B is also an effective antioxidant, showing activity against lipid peroxidation and reactive oxygen species.

Purity :
>98%

Specifications :
null

Price.:
null

Price unit :
$

Inventory :

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.
Related websites: https://www.medchemexpress.com
58-05-9 site 154229-18-2 Formula PMID:30969518 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Recombinant Human DCT

Brief Description :
Recombinant Protein

Accession No. :
Swissprot:P40126Gene Accession:BC028311

Calculated MW :

Target Sequence :

Storage :
-20~-80˚C, pH 7.6 PBS

Application Details :

Uniprot :
P40126

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
CPDA medchemexpress ARL3 Antibody supplier PMID:35007372 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
m-dPEG®24-MAL

Synonym :

Chemical Name :

CAS NO.:
88504-24-9

Molecular formula :
C22H39 F3N4O7 S

Molecular Weight:
560.63 g/mol

Classification :
MedChemExpress Products > Life Sciences > m-dPEG®24-MAL

Description:
m-dPEG®24-MAL is a peptide that is used as a research tool in cell biology to study protein interactions, receptor binding and pharmacology. This peptide can be used to inhibit ion channels by blocking the ligand binding site. It also has affinity for certain antibodies and can be used to activate them. m-dPEG®24-MAL has CAS No. 88504-24-9, which is registered with the Chemical Abstracts Service of the American Chemical Society.

Purity :
>98%

Specifications :
null

Price.:
null

Price unit :
$

Inventory :

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.
Related websites: https://www.medchemexpress.com
1405-10-3 Biological Activity 9003-99-0 supplier PMID:28613735 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Recombinant Human SELPLG

Brief Description :
Recombinant Protein

Accession No. :
Swissprot:Q14242Gene Accession:BC029782

Calculated MW :

Target Sequence :

Storage :
-20~-80˚C, pH 7.6 PBS

Application Details :

Uniprot :
Q14242

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Favipiravir custom synthesis 1,4-Di-tert-butylbenzene Biological Activity PMID:35133832 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Chk2 Inhibitor II

Synonym :

Chemical Name :

CAS NO.:
516480-79-8

Molecular formula :
C20H14ClN3O2

Molecular Weight:
363.8 g/mol

Classification :
MedChemExpress Products > Research Chemicals > Chk2 Inhibitor II

Description:
Chk2 inhibitor II is a monoclonal antibody that binds to Chk2, an enzyme that is involved in the regulation of DNA repair and replication. It inhibits the phosphorylation of Chk2 by upstream kinases, leading to decreased levels of phosphorylated Chk2. In vitro studies have shown that Chk2 inhibitor II can inhibit herpes simplex virus replication and activate autophagy. This drug has also been shown to be effective against cancer cells in vitro and in vivo.

Purity :
>98%

Specifications :
10 mM * 1 mL

Price.:
66

Price unit :
$

Inventory :
In stock

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.
Related websites: https://www.medchemexpress.com
18883-66-4 Formula 495-60-3 manufacturer PMID:31082163 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Recombinant Human Interleukin-37,IL-37

Brief Description :

Accession No. :
Q9NZH6.2

Calculated MW :
18.7kDa

Target Sequence :
MKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD

Storage :
Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7C for 2-7 days.Aliquots of reconstituted samples are stable at < -20C for 3 months.

Application Details :

Uniprot :
Q9NZH6

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Glycerol-d5 In Vitro RBMS1 Antibody manufacturer PMID:34059342 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Cardiogenol C

Synonym :

Chemical Name :

CAS NO.:
671225-39-1

Molecular formula :
C13H16N4O2

Molecular Weight:
260.29 g/mol

Classification :
MedChemExpress Products > Research Chemicals > Cardiogenol C

Description:
Cardiogenol C is a molecule derived from the bark of the Amazonian plant Ocotea pretiosa. Cardiogenol C has been shown to stimulate the growth of cardiac tissue in cell culture, and has been shown to have clinical relevance for diabetic patients with congestive heart failure. Cardiogenol C induces cellular dedifferentiation and differentiation, which may be due to its ability to activate the colony-stimulating factor (CSF) receptor on cardiac cells. Cardiogenol C also activates epidermal growth factor receptors (EGFR) and vascular endothelial growth factor receptors (VEGFR), leading to increased production of CSF and other molecules that are important for cardiac regeneration.

Purity :
>98%

Specifications :
null

Price.:
null

Price unit :
$

Inventory :

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.
Related websites: https://www.medchemexpress.com
1956370-21-0 Formula 1220411-29-9 Biological Activity PMID:31112109 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Recombinant Human IRF6

Brief Description :
Recombinant Protein

Accession No. :
Swissprot:O14896Gene Accession:BC014852

Calculated MW :

Target Sequence :

Storage :
-20~-80˚C, pH 7.6 PBS

Application Details :

Uniprot :
O14896

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
C-MYC Antibody Autophagy CD2 Antibody supplier PMID:35120484 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com