Product Name :
9-Hydroxyellipticine Hydrochloride

Synonym :

Chemical Name :

CAS NO.:
52238-35-4

Molecular formula :
C17H14N2O•HCl

Molecular Weight:
262.31 g/mol

Classification :
MedChemExpress Products > Research Chemicals > 9-Hydroxyellipticine Hydrochloride

Description:
9-Hydroxyellipticine Hydrochloride is a synthetic analog of the natural compound ellipticine. It inhibits the transcriptional regulation of growth factors and receptors, which may be related to its anticancer activity. 9-Hydroxyellipticine Hydrochloride has been shown to inhibit cellular growth by binding to single-stranded DNA, causing cell death. This drug also inhibits platelet-derived growth factor (PDGF) receptor phosphorylation, which causes acute lung inflammation in mice. 9-Hydroxyellipticine Hydrochloride has been shown to bind to the factor X receptor (FXR), inhibiting protein synthesis and cell growth in cultured cells. The diagnostic applications of this drug are currently being explored.

Purity :
>98%

Specifications :
1 mg

Price.:
74

Price unit :
$

Inventory :
Out of stock

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.
Related websites: https://www.medchemexpress.com
19983-44-9 SMILES 176161-24-3 IUPAC Name PMID:28613582 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Macrosialin

Brief Description :
Recombinant Protein

Accession No. :
P31996Gene name:Cd68

Calculated MW :
29.81

Target Sequence :

Storage :
Store at -20C. (Avoid repeated freezing and thawing.)Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Application Details :

Uniprot :
P31996

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
ARHGDIA Antibody In Vitro DOHH Antibody Epigenetic Reader Domain PMID:34505524 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
MG 624

Synonym :

Chemical Name :

CAS NO.:
77257-42-2

Molecular formula :
C22H30INO

Molecular Weight:
451.38 g/mol

Classification :
MedChemExpress Products > Life Sciences > Ligands > MG 624

Description:
MG 624 is a synthetic agonist of the α7 nicotinic acetylcholine receptor (α7nAChR). It has been shown to inhibit angiogenesis, which is the growth of new blood vessels from pre-existing ones. MG 624 binds to the α7nAChR and blocks its signaling pathways, which leads to an increase in acetylcholine levels. This drug has also been shown to have anti-angiogenic effects in animal models. MG 624 is not very effective against bladder cancer cells but does inhibit the growth of other types of cancer cells such as prostate, breast and colon cancer cells. MG 624 may be used for the treatment of various cancers or for diabetic retinopathy.

Purity :
>98%

Specifications :
5 mg

Price.:
120

Price unit :
$

Inventory :
In stock

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.
Related websites: https://www.medchemexpress.com
611168-24-2 manufacturer 38966-21-1 InChIKey PMID:30000643 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Apoptosis-associated speck-like protein containing a CARD

Brief Description :
Recombinant Protein

Accession No. :
Q9ULZ3Gene name:PYCARD

Calculated MW :
21.45

Target Sequence :

Storage :
Store at -20C. (Avoid repeated freezing and thawing.)Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Application Details :

Uniprot :
Q9ULZ3

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
TNFRSF10D Antibody In Vitro Telotristat ethyl Data Sheet PMID:34875552 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Taurodeoxychloic acid

Synonym :

Chemical Name :

CAS NO.:
516-50-7

Molecular formula :
C26H45NO6S

Molecular Weight:
499.7 g/mol

Classification :
MedChemExpress Products > Research Chemicals > Taurodeoxychloic acid

Description:
Taurodeoxycholic acid (TDCA) is a bile acid that is synthesized from cholesterol in the liver. TDCA is conjugated with glycine to form taurodeoxycholate, which is then secreted into the bile and aids in digestion. TDCA has been shown to induce apoptosis by activating the death receptor pathway and inhibiting protein synthesis. It also inhibits inflammation by suppressing the production of pro-inflammatory cytokines such as tumor necrosis factor alpha (TNF-α), interleukin-1 beta (IL-1β), and IL-6. Taurodeoxycholic acid has been shown to be useful in treating injury due to its ability to reduce dextran sulfate binding to tissue proteins, preventing tissue injury and cell death.

Purity :
>98%

Specifications :
10 mM * 1 mL

Price.:
374

Price unit :
$

Inventory :
In stock

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.
Related websites: https://www.medchemexpress.com
21215-62-3 web 58001-44-8 Formula PMID:26247091 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Recombinant Human Ly6,PLAUR Domain-Containing Protein 3,LYPD3,C4.4A (C-6His)

Brief Description :

Accession No. :
O95274

Calculated MW :
27.89kDa

Target Sequence :
LECYSCVQKADDGCSPNKMKTVKCAPGVDVCTEAVGAVETIHGQFSLAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNLTSRALDPAGNESAYPPNGVECYSCVGLSREACQGTSPPVVSCYNASDHVYKGCFDGNVTLTAANVTVSLPVRGCVQDEFCTRDGVTGPGFTLSGSCCQGSRCNSDLRNKTYFSPRIPPLVRLPPPEPTTVASTTSVTTSTSAPVRPTSTTKPMPAPTSQTPRQGVEHVDHHHHHH

Storage :
Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7C for 2-7 days.Aliquots of reconstituted samples are stable at < -20C for 3 months.

Application Details :

Uniprot :
O95274

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
CTGF Antibody Biological Activity Esaxerenone Vitamin D Related/Nuclear Receptor PMID:34997938 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Triethylene glycol

Synonym :

Chemical Name :

CAS NO.:
112-27-6

Molecular formula :
C6H14O4

Molecular Weight:
150.17 g/mol

Classification :
MedChemExpress Products > Research Chemicals > Triethylene glycol

Description:
Triethylene glycol is a polyether that is used as a solvent and an additive in various products. Triethylene glycol can be found in water-based paints, cosmetics, and polyurethane plastics. It has a low toxicity to humans and animals. The rate constant of the reaction between triethylene glycol and coumarin derivatives has been determined by fluorescence probe techniques. The polymerization mechanism of triethylene glycol has been studied with the aid of polyvinyl alcohol (PVA) as a model system. This polymerization mechanism depends on the coordination geometry of the reactants. The polymerization of triethylene glycol is initiated by oxidative addition to produce the monoethyl ether followed by elimination to form the corresponding diols, which are then oxidized to give the final product. Triethylene glycol is also used in cell nuclei staining techniques to identify nuclear morphology or DNA content.

Purity :
>98%

Specifications :
5 g

Price.:
25

Price unit :
$

Inventory :
In stock

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.
Related websites: https://www.medchemexpress.com
122320-73-4 medchemexpress 58-05-9 web PMID:31082085 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
N-glycosylase/DNA lyase

Brief Description :
Recombinant Protein

Accession No. :
O15527Gene name:OGG1

Calculated MW :
16.5

Target Sequence :

Storage :
Store at -20C. (Avoid repeated freezing and thawing.)Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Application Details :

Uniprot :
O15527

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
AK1 Antibody MedChemExpress IGF1 Antibody manufacturer PMID:35213978 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Starch from potato

Synonym :

Chemical Name :

CAS NO.:
9005-25-8

Molecular formula :

Molecular Weight:

Classification :
MedChemExpress Products > Carbohydrates > Polysaccharides > Polysaccharides from Higher Plants > Starch from potato

Description:
Starch is an energy storing polysaccharide produced by higher plants and some algae. Pure starch is a white, tasteless and odorless powder that is insoluble in cold water or alcohol. It consists of two types of polysaccharide: the linear and helical amylose (α-1,4-linked glucose) and the branched amylopectin (α-1,4 and α-1,6-linked glucose). Depending on the plant, starch generally contains 20 to 25% amylose and 75 to 80% amylopectin by weight.

Purity :
>98%

Specifications :
100 g

Price.:
30

Price unit :
$

Inventory :
In stock

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.
Related websites: https://www.medchemexpress.com
1374248-81-3 Description 59-92-7 supplier PMID:28613558 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Tachykinin-3

Brief Description :
Recombinant Protein

Accession No. :
Q9UHF0Gene name:TAC3

Calculated MW :

Target Sequence :

Storage :
Store at -20C. (Avoid repeated freezing and thawing.)Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Application Details :

Uniprot :
Q9UHF0

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
TNFRSF11B Antibody Purity & Documentation Phospho-DRP1(Ser616) Antibody Autophagy PMID:35069823 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com