Product Name :
Taurodeoxychloic acid

Synonym :

Chemical Name :

CAS NO.:
516-50-7

Molecular formula :
C26H45NO6S

Molecular Weight:
499.7 g/mol

Classification :
MedChemExpress Products > Research Chemicals > Taurodeoxychloic acid

Description:
Taurodeoxycholic acid (TDCA) is a bile acid that is synthesized from cholesterol in the liver. TDCA is conjugated with glycine to form taurodeoxycholate, which is then secreted into the bile and aids in digestion. TDCA has been shown to induce apoptosis by activating the death receptor pathway and inhibiting protein synthesis. It also inhibits inflammation by suppressing the production of pro-inflammatory cytokines such as tumor necrosis factor alpha (TNF-α), interleukin-1 beta (IL-1β), and IL-6. Taurodeoxycholic acid has been shown to be useful in treating injury due to its ability to reduce dextran sulfate binding to tissue proteins, preventing tissue injury and cell death.

Purity :
>98%

Specifications :
10 mM * 1 mL

Price.:
374

Price unit :
$

Inventory :
In stock

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.
Related websites: https://www.medchemexpress.com
21215-62-3 web 58001-44-8 Formula PMID:26247091 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Recombinant Human Ly6,PLAUR Domain-Containing Protein 3,LYPD3,C4.4A (C-6His)

Brief Description :

Accession No. :
O95274

Calculated MW :
27.89kDa

Target Sequence :
LECYSCVQKADDGCSPNKMKTVKCAPGVDVCTEAVGAVETIHGQFSLAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNLTSRALDPAGNESAYPPNGVECYSCVGLSREACQGTSPPVVSCYNASDHVYKGCFDGNVTLTAANVTVSLPVRGCVQDEFCTRDGVTGPGFTLSGSCCQGSRCNSDLRNKTYFSPRIPPLVRLPPPEPTTVASTTSVTTSTSAPVRPTSTTKPMPAPTSQTPRQGVEHVDHHHHHH

Storage :
Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7C for 2-7 days.Aliquots of reconstituted samples are stable at < -20C for 3 months.

Application Details :

Uniprot :
O95274

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
CTGF Antibody Biological Activity Esaxerenone Vitamin D Related/Nuclear Receptor PMID:34997938 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Triethylene glycol

Synonym :

Chemical Name :

CAS NO.:
112-27-6

Molecular formula :
C6H14O4

Molecular Weight:
150.17 g/mol

Classification :
MedChemExpress Products > Research Chemicals > Triethylene glycol

Description:
Triethylene glycol is a polyether that is used as a solvent and an additive in various products. Triethylene glycol can be found in water-based paints, cosmetics, and polyurethane plastics. It has a low toxicity to humans and animals. The rate constant of the reaction between triethylene glycol and coumarin derivatives has been determined by fluorescence probe techniques. The polymerization mechanism of triethylene glycol has been studied with the aid of polyvinyl alcohol (PVA) as a model system. This polymerization mechanism depends on the coordination geometry of the reactants. The polymerization of triethylene glycol is initiated by oxidative addition to produce the monoethyl ether followed by elimination to form the corresponding diols, which are then oxidized to give the final product. Triethylene glycol is also used in cell nuclei staining techniques to identify nuclear morphology or DNA content.

Purity :
>98%

Specifications :
5 g

Price.:
25

Price unit :
$

Inventory :
In stock

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.
Related websites: https://www.medchemexpress.com
122320-73-4 medchemexpress 58-05-9 web PMID:31082085 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
N-glycosylase/DNA lyase

Brief Description :
Recombinant Protein

Accession No. :
O15527Gene name:OGG1

Calculated MW :
16.5

Target Sequence :

Storage :
Store at -20C. (Avoid repeated freezing and thawing.)Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Application Details :

Uniprot :
O15527

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
AK1 Antibody MedChemExpress IGF1 Antibody manufacturer PMID:35213978 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Starch from potato

Synonym :

Chemical Name :

CAS NO.:
9005-25-8

Molecular formula :

Molecular Weight:

Classification :
MedChemExpress Products > Carbohydrates > Polysaccharides > Polysaccharides from Higher Plants > Starch from potato

Description:
Starch is an energy storing polysaccharide produced by higher plants and some algae. Pure starch is a white, tasteless and odorless powder that is insoluble in cold water or alcohol. It consists of two types of polysaccharide: the linear and helical amylose (α-1,4-linked glucose) and the branched amylopectin (α-1,4 and α-1,6-linked glucose). Depending on the plant, starch generally contains 20 to 25% amylose and 75 to 80% amylopectin by weight.

Purity :
>98%

Specifications :
100 g

Price.:
30

Price unit :
$

Inventory :
In stock

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.
Related websites: https://www.medchemexpress.com
1374248-81-3 Description 59-92-7 supplier PMID:28613558 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Tachykinin-3

Brief Description :
Recombinant Protein

Accession No. :
Q9UHF0Gene name:TAC3

Calculated MW :

Target Sequence :

Storage :
Store at -20C. (Avoid repeated freezing and thawing.)Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Application Details :

Uniprot :
Q9UHF0

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
TNFRSF11B Antibody Purity & Documentation Phospho-DRP1(Ser616) Antibody Autophagy PMID:35069823 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Dencichine

Synonym :

Chemical Name :

CAS NO.:
5302-45-4

Molecular formula :
C5H8N2O5

Molecular Weight:
176.13 g/mol

Classification :
MedChemExpress Products > Research Chemicals > Dencichine

Description:
Dencichine is an anti-inflammatory and anti-ulcer agent that has been shown to prevent oxidative injury in the bowel. The mechanism of this drug is not yet known, but it may be due to its antioxidant properties. Dencichine also has a protective effect on the epithelial cells and prevents the loss of cell-to-cell contact. This drug also has been shown to have a protective effect against bowel disease in mice. Dencichine is absorbed by the intestine, with high water permeability, and accumulates in the bowel. It inhibits intestinal inflammation by inhibiting prostaglandin synthesis, which may be due to its inhibition of cyclooxygenase or lipoxygenase activity.

Purity :
>98%

Specifications :
10 mM * 1 mL

Price.:
182

Price unit :
$

Inventory :
In stock

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.
Related websites: https://www.medchemexpress.com
53-86-1 Formula 849214-04-6 manufacturer PMID:30321012 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Coagulation factor XI

Brief Description :
Recombinant Protein

Accession No. :
P03951Gene name:F11

Calculated MW :
26.18

Target Sequence :

Storage :
Store at -20C. (Avoid repeated freezing and thawing.)Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Application Details :

Uniprot :
P03951

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Cy5-DBCO Epigenetics CD38 Antibody Purity PMID:34968408 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
1,2-O-Isopropylidene-a-D-xylofuranose

Synonym :
1,2-O-(1-Methylethylidene)-a-D-xylofuranoseMAX

Chemical Name :

CAS NO.:
20031-21-4

Molecular formula :
C8H14O5

Molecular Weight:
190.19 g/mol

Classification :
MedChemExpress Products > Carbohydrates > Monosaccharides > 1,2-O-Isopropylidene-a-D-xylofuranose

Description:
Chiral building block for synthesis of carbohydrate and nucleoside derivatives

Purity :
>98%

Specifications :
5 g

Price.:
30

Price unit :
$

Inventory :
In stock

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.
Related websites: https://www.medchemexpress.com
2627-69-2 IUPAC Name 9001-73-4 site PMID:30285350 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Beta-defensin 1

Brief Description :
Recombinant Protein

Accession No. :
P60022Gene name:DEFB1

Calculated MW :
3.96

Target Sequence :

Storage :
Store at -20C. (Avoid repeated freezing and thawing.)Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Application Details :

Uniprot :
P60022

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
KIF6 Antibody Technical Information RAD50 Antibody MedChemExpress PMID:35034519 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com