Name :
DHH (Human) Recombinant Protein
Biological Activity :
Human DHH partial recombinant protein with His tag in N-terminus expressed in Escherichia coli.
Tag :
Protein Accession No. :
O43323
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=50846
Amino Acid Sequence :
MGSSHHHHHHSSGLVPRGSHMCGPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHVHVSVKADNSLAVRAGG
Molecular Weight :
22
Storage and Stability :
Store at 4°C for 2-4 weeks and should be stored at -20°C to -80°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid repeated freeze/thaw cycles.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Quality Control Testing :
Storage Buffer :
Solution containing 20 mM MES ,pH 5.5, 20% glycerol, 0.5 mM DTT.
Applications :
SDS-PAGE，
Gene Name :
DHH
Gene Alias :
HHG-3, MGC35145
Gene Description :
desert hedgehog homolog (Drosophila)
Gene Summary :
This gene encodes a member of the Hedgehog family. The hedgehog gene family encodes signaling molecules that play an important role in regulating morphogenesis. This protein is predicted to be made as a precursor that is autocatalytically cleaved; the N-terminal portion is soluble and contains the signalling activity while the C-terminal portion is involved in precursor processing. More importantly, the C-terminal product covalently attaches a cholesterol moiety to the N-terminal product, restricting the N-terminal product to the cell surface and preventing it from freely diffusing throughout the organism. Defects in this protein have been associated with partial gonadal dysgenesis (PGD) accompanied by minifascicular polyneuropathy. This protein may be involved in both male gonadal differentiation and perineurial development. [provided by RefSeq
Other Designations :
desert hedgehog
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-7 ProteinStorage & Stability
IL-35 web
Popular categories:
CEA Cell Adhesion Molecule 7 (CEACAM7)
NKG2C/CD159c
