Name :
CD47 (Human) Recombinant Protein
Biological Activity :
Human CD47 (Q08722, 19 a.a. – 141 a.a.) partial length recombinant protein His tag expressed in Baculovirus expression system.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins
Tag :
Result of bioactivity analysis
Protein Accession No. :
Q08722
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=961
Amino Acid Sequence :
QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNE
Molecular Weight :
14.7
Storage and Stability :
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
Viruses
Interspecies Antigen Sequence :
Preparation Method :
Baculovirus expression system
Purification :
Quality Control Testing :
3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer :
In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Applications :
Functional Study, SDS-PAGE,
Gene Name :
CD47
Gene Alias :
IAP, MER6, OA3
Gene Description :
CD47 molecule
Gene Summary :
This gene encodes a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This gene has broad tissue distribution, and is reduced in expression on Rh erythrocytes. Four alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq
Other Designations :
CD47 antigen|CD47 antigen (Rh-related antigen, integrin-associated signal transducer)|CD47 glycoprotein|Rh-related antigen|antigen identified by monoclonal antibody 1D8|antigenic surface determinant protein OA3|integrin associated protein|integrin-associa
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-1 alpha Proteinweb
IL-3 Protein, Mouse (His)Accession
Popular categories:
Activated Cdc42-Associated Kinase 1 (ACK1)
Retinoid X Receptor gamma