Name :
PPIF (Human) Recombinant Protein
Biological Activity :
Human PPIF (NP_005720, 30 a.a. – 207 a.a.) partial recombinant protein expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins
Tag :
Protein Accession No. :
NP_005720
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=10105
Amino Acid Sequence :
MGSSHHHHHHSSGLVPRGSHCSKGSGDPSSSSSSGNPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS
Molecular Weight :
21
Storage and Stability :
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Conventional Chromatography
Quality Control Testing :
Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer :
In 20 mM Tris, pH 7.5 (1 mM DTT, 10% glycerol).
Applications :
Functional Study， SDS-PAGE，
Gene Name :
PPIF
Gene Alias :
CYP3, Cyp-D, FLJ90798, MGC117207
Gene Description :
peptidylprolyl isomerase F
Gene Summary :
The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is part of the mitochondrial permeability transition pore in the inner mitochondrial membrane. Activation of this pore is thought to be involved in the induction of apoptotic and necrotic cell death. [provided by RefSeq
Other Designations :
OTTHUMP00000019925|PPIase|cyclophilin 3|cyclophilin D|cyclophilin F|peptidyl-prolyl cis-trans isomerase, mitochondral|rotamase
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CX3CL1 Recombinant Proteins
B7-H3 Recombinant Proteins
Popular categories:
CD30 Ligand
Complement Receptor 4
