Share this post on:

Name :
CD7 (Human) Recombinant Protein

Biological Activity :
Human CD7 (P09564, 26 a.a. – 180 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.

Tag :

Protein Accession No. :
P09564

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=924

Amino Acid Sequence :
MGSSHHHHHHSSGLVPRGSHMGSAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP

Molecular Weight :
18.8

Storage and Stability :
Store at 2°C to 8°C for 2-4 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.

Host :
Escherichia coli

Interspecies Antigen Sequence :

Preparation Method :
Escherichia coli expression system

Purification :

Quality Control Testing :

Storage Buffer :
In 20mM Tris-HCl pH 8.0 (0.4 M Urea and 10% glycerol)

Applications :
SDS-PAGE,

Gene Name :
CD7

Gene Alias :
GP40, LEU-9, TP41, Tp40

Gene Description :
CD7 molecule

Gene Summary :
This gene encodes a transmembrane protein which is a member of the immunoglobulin superfamily. This protein is found on thymocytes and mature T cells. It plays an essential role in T-cell interactions and also in T-cell/B-cell interaction during early lymphoid development. [provided by RefSeq

Other Designations :
CD7 antigen|CD7 antigen (p41)|T-cell antigen CD7|T-cell leukemia antigen|p41 protein

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-23 Recombinant Proteins
CNTF web
Popular categories:
TNF Superfamily Ligands
CD319/SLAMF7

Share this post on:

Author: Ubiquitin Ligase- ubiquitin-ligase