Product Name :
N-acetylneuraminic acid synthase
Target gene :
NANS
verified_species_reactivity :
Human
interspecies_information :
86%, ENSMUSG00000028334, species_id: MOUSE, 88%, ENSRNOG00000008945, species_id: RAT
clonality :
Polyclonal
isotype :
IgG
host :
Rabbit
buffer :
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
purification_method :
Affinity purified using the PrEST antigen as affinity ligand
antigen_sequence :
LPCEMACNEKLGKSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEELVDNHG
references :
Characterization data on the Human Protein Atlas”, This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies
shipping:
Normally shipped at ambient temperature
storage :
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Ensembl :
ENSG00000095380
Entrez :
54187
UniProt :
Q9NR45
Dilution:
1:200 – 1:500
Retrieval method :
HIER pH6
Related websites: https://www.medchemexpress.com/antibodies.html
134448-10-5 MedChemExpress 1792180-81-4 Protocol PMID:30422470 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
